BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_L21 (662 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 161 5e-42 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 161 bits (391), Expect = 5e-42 Identities = 77/79 (97%), Positives = 77/79 (97%) Frame = +3 Query: 387 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEANGIHETTYNSIMKC 566 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEA GIHETTYNSIMKC Sbjct: 1 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 60 Query: 567 DVXIRKDLYANTVLSGGTT 623 DV IRKDLYANTVLSGGTT Sbjct: 61 DVDIRKDLYANTVLSGGTT 79 Score = 27.5 bits (58), Expect = 0.12 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +2 Query: 623 MYPGIGDRMPKEI 661 MYPGI DRM KEI Sbjct: 80 MYPGIADRMQKEI 92 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,116 Number of Sequences: 438 Number of extensions: 4546 Number of successful extensions: 7 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -