BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_L15 (524 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g54030.1 68418.m06720 DC1 domain-containing protein contains ... 33 0.12 At2g17620.1 68415.m02038 cyclin, putative (CYC2a) similar to cyc... 31 0.47 At5g60920.1 68418.m07642 phytochelatin synthetase, putative / CO... 31 0.63 At4g01575.1 68417.m00205 serine protease inhibitor, Kazal-type f... 31 0.63 At5g05660.1 68418.m00622 zinc finger (NF-X1 type) family protein... 30 1.1 At3g17750.1 68416.m02265 protein kinase family protein contains ... 30 1.1 At5g55960.1 68418.m06979 expressed protein 29 2.5 At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type f... 29 2.5 At3g32904.1 68416.m04164 hypothetical protein 29 2.5 At1g73460.1 68414.m08504 protein kinase family protein contains ... 29 2.5 At1g73450.1 68414.m08503 protein kinase, putative similar to nuc... 29 2.5 At5g56050.1 68418.m06993 hypothetical protein 28 4.4 At1g61870.1 68414.m06981 pentatricopeptide (PPR) repeat-containi... 28 4.4 At5g42620.1 68418.m05188 expressed protein 27 7.7 >At5g54030.1 68418.m06720 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 419 Score = 33.1 bits (72), Expect = 0.12 Identities = 18/68 (26%), Positives = 30/68 (44%) Frame = +3 Query: 135 KIYSPVCGSDGKTYENPCEFYCEKDKTHSNMTIVKNTACEVGIPCYCTLEYAPVCGSNGK 314 K+Y+ + S G+ YEN C F C+ + + T C + + C P+ S K Sbjct: 83 KVYTHIFTSSGRIYENTCHF-CQ---SKLEFLFARCTICNLNVDIECLFALPPLTISEPK 138 Query: 315 TYANKCSL 338 + + SL Sbjct: 139 HHKHSLSL 146 >At2g17620.1 68415.m02038 cyclin, putative (CYC2a) similar to cyclin 2b protein [Arabidopsis thaliana] GI:509423; contains Pfam profiles PF00134: Cyclin, N-terminal domain, PF02984: Cyclin, C-terminal domain; identical to cDNA cyc2a mRNA for cyclin 2a protein GI:728518 Length = 429 Score = 31.1 bits (67), Expect = 0.47 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +3 Query: 93 YSVTALPPPLCICGKIYSPVCGSDG-KTYENPCEFYC 200 Y + PP L +Y+ C DG + + + CEF+C Sbjct: 336 YEMLRFPPSLLAATSVYTAQCTLDGSRKWNSTCEFHC 372 >At5g60920.1 68418.m07642 phytochelatin synthetase, putative / COBRA cell expansion protein COB, putative similar to phytochelatin synthetase GI:29570314; similar to GB:AAK56072; identified in Roudier, et al, Plant Phys. (2002) 130:538-548 (PMID:12376623); identical to cDNA putative phytochelatin synthetase GI:3559804; contains Pfam profile PF04833: Phytochelatin synthetase-like conserved region Length = 456 Score = 30.7 bits (66), Expect = 0.63 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 2/60 (3%) Frame = +1 Query: 241 TPH-ARWASPATVPWN-MPPSVALTEKLTPTNVHWNAPKRLYRL*RWNMMANARELNWRV 414 TPH A SP T +PP V T + P VHW+ K+ Y+ W + N+R+ Sbjct: 270 TPHLASVVSPPTKKGTVLPPLVQCTRHMCPIRVHWHV-KQNYKE-YWRVKITITNFNYRL 327 >At4g01575.1 68417.m00205 serine protease inhibitor, Kazal-type family protein contains Pfam domain PF00050: Kazal-type serine protease inhibitor domain Length = 144 Score = 30.7 bits (66), Expect = 0.63 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 4/44 (9%) Frame = +3 Query: 357 IPSLKMEHD---GE-CQGAKLASLHPCICTREKDPVCGSDGVTY 476 +PS K+ + GE C+G + P C R DPVCG D VTY Sbjct: 47 LPSEKINGEKNRGEFCEGIAKPASCPVQCFRP-DPVCGEDSVTY 89 Score = 27.5 bits (58), Expect = 5.8 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 147 PVCGSDGKTYENPCEFYCEKDKTHSNMTIVKNTACEVG 260 PVCG D TY C D + +VK AC+VG Sbjct: 80 PVCGEDSVTYWCGC-----ADALCHGVRVVKQGACDVG 112 >At5g05660.1 68418.m00622 zinc finger (NF-X1 type) family protein contains PF01422: NF-X1 type zinc finger Length = 912 Score = 29.9 bits (64), Expect = 1.1 Identities = 27/119 (22%), Positives = 45/119 (37%), Gaps = 10/119 (8%) Frame = +3 Query: 120 LCICGKIYSPVCGSDGKTYENPCEFYCEKDKT----HSNMTIVKNTACE-----VGIPCY 272 LC CGK P + + C CE+ + H + + C V C+ Sbjct: 165 LCYCGKEEDPPADNPW-ILPHSCGEVCERPLSNNCGHCCLLLCHPGPCASCPKLVKAKCF 223 Query: 273 CT-LEYAPVCGSNGKTYANKCSLECTQKIIPSLKMEHDGECQGAKLASLHPCICTREKD 446 C +E CG + + C I ++ HDGEC + +++ C C + K+ Sbjct: 224 CGGVEDVRRCGHKQFSCGDVCERVLDCNIHNCREICHDGECPPCRERAVYKCSCGKVKE 282 >At3g17750.1 68416.m02265 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 1138 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = -3 Query: 168 YHLTRRRDYRFFRKYITAVAELLPSIL 88 YHL R DY +FR+++ V ELL + L Sbjct: 887 YHLLRLYDYFYFREHLLIVCELLKANL 913 >At5g55960.1 68418.m06979 expressed protein Length = 648 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = -3 Query: 342 IPVNICWRKFFR-*SHRRGHIPRYSSRGCPPR 250 IP N+ W++ FR S R+ P SS PPR Sbjct: 14 IPTNLAWQEMFRSASSRKPQDPPSSSSSSPPR 45 >At3g61980.1 68416.m06961 serine protease inhibitor, Kazal-type family protein contains Pfam domain PF00050: Kazal-type serine protease inhibitor domain Length = 117 Score = 28.7 bits (61), Expect = 2.5 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 444 DPVCGSDGVTY 476 DPVCG+DGVTY Sbjct: 52 DPVCGTDGVTY 62 Score = 28.3 bits (60), Expect = 3.3 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 147 PVCGSDGKTYENPCEFYCEKDKTHSNMTIVKNTACEVG 260 PVCG+DG TY C D +VK AC+ G Sbjct: 53 PVCGTDGVTYWCGC-----PDAACHGARVVKKGACDTG 85 >At3g32904.1 68416.m04164 hypothetical protein Length = 330 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = +1 Query: 253 RWASPATVP-WNMPPSVALTEKLTPTNVHWNAPKRLYRL*RWNMMANARELN 405 +W +P T P WN P +V + PT W P + +W+ A +L+ Sbjct: 276 QWGTPPTAPQWNSPSNVPQWT-IPPTTPQWGTPSSMP---QWSSSPTAPQLS 323 >At1g73460.1 68414.m08504 protein kinase family protein contains protein kinase domain Pfam:PF00069 Length = 1169 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 168 YHLTRRRDYRFFRKYITAVAELLPSIL 88 YHL R DY ++R+++ V ELL + L Sbjct: 918 YHLLRLYDYFYYREHLLIVCELLKANL 944 >At1g73450.1 68414.m08503 protein kinase, putative similar to nuclear serine/threonine protein kinase GI:3582644 from [Rattus norvegicus] Length = 1152 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -3 Query: 168 YHLTRRRDYRFFRKYITAVAELLPSIL 88 YHL R DY ++R+++ V ELL + L Sbjct: 901 YHLLRLYDYFYYREHLLIVCELLKANL 927 >At5g56050.1 68418.m06993 hypothetical protein Length = 283 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = +1 Query: 238 KTPHARWASPATVPWNMPP-SVALTEKLTP 324 +TP ++W SP PW P S T TP Sbjct: 21 ETPSSKWYSPIYTPWRTTPRSTQSTPTTTP 50 >At1g61870.1 68414.m06981 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 408 Score = 27.9 bits (59), Expect = 4.4 Identities = 17/71 (23%), Positives = 28/71 (39%), Gaps = 3/71 (4%) Frame = +3 Query: 171 TYENPCEFYCEKDKTHSNMTIVK---NTACEVGIPCYCTLEYAPVCGSNGKTYANKCSLE 341 TY + +C +D + K N C+ CY TL Y G + +T + C Sbjct: 294 TYSHLIHGFCNEDDFEEAKKLFKIMVNRGCKPDSECYFTLIYYLCKGGDFETALSLCKES 353 Query: 342 CTQKIIPSLKM 374 + +PS + Sbjct: 354 MEKNWVPSFSI 364 >At5g42620.1 68418.m05188 expressed protein Length = 841 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +3 Query: 294 VCGSNGKTYANKC--SLECTQKIIPSLKMEHDGECQGA 401 VC S ++Y C SL+C+ + + S E D EC G+ Sbjct: 786 VCHSACQSYNMACGASLDCSDQTLFSTAEEGDAECTGS 823 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,485,865 Number of Sequences: 28952 Number of extensions: 286169 Number of successful extensions: 739 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 717 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 739 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 967280384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -