BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_L14 (533 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC30B4.06c |||tRNA uridine 5-carboxymethylaminomethyl modifica... 29 0.33 SPBC530.06c |||translation initiation factor eIF3 alpha subunit ... 27 1.3 SPAC4G9.17c |mrps5||mitochondrial ribosomal protein subunit S5|S... 25 7.1 SPAC1687.09 |||conserved fungal protein|Schizosaccharomyces pomb... 25 7.1 SPBC1718.05 |trs31||TRAPP complex subunit Trs31 |Schizosaccharom... 25 9.4 SPAC6G10.08 |idp1||isocitrate dehydrogenase Idp1|Schizosaccharom... 25 9.4 SPAC1B3.10c |||SEL1 repeat protein, unknown biological role|Schi... 25 9.4 >SPBC30B4.06c |||tRNA uridine 5-carboxymethylaminomethyl modification enzyme|Schizosaccharomyces pombe|chr 2|||Manual Length = 666 Score = 29.5 bits (63), Expect = 0.33 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 277 KPPTLDPNEWWGPNELN 327 +P LDPN WW PN L+ Sbjct: 315 EPEGLDPNSWWYPNGLS 331 >SPBC530.06c |||translation initiation factor eIF3 alpha subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 1173 Score = 27.5 bits (58), Expect = 1.3 Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Frame = -1 Query: 404 NRCFKSLIITSWNLILKGLILISFLVFSSF----GPHHSLGSRVGGF 276 N CF+SL ++ WN + ++ L++ + G +++ S V GF Sbjct: 200 NGCFRSLALSGWNPVPAEFVIQGHLLYLTVLTIEGKTYNITSHVSGF 246 >SPAC4G9.17c |mrps5||mitochondrial ribosomal protein subunit S5|Schizosaccharomyces pombe|chr 1|||Manual Length = 387 Score = 25.0 bits (52), Expect = 7.1 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 370 QEVMISDLKQRLKNHRPF 423 ++V I +LK R K+H PF Sbjct: 101 EDVSIEELKSRFKDHLPF 118 >SPAC1687.09 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1379 Score = 25.0 bits (52), Expect = 7.1 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 316 NELNTKNDISIRPFKIKFQEVMISDLKQRLKN--HRPFV 426 +E+N K +S+ K+ FQE S LK++ N H P V Sbjct: 652 SEVNLKKSLSLASSKLSFQEAGTS-LKEKTANVQHSPEV 689 >SPBC1718.05 |trs31||TRAPP complex subunit Trs31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 209 Score = 24.6 bits (51), Expect = 9.4 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = +1 Query: 379 MISDLKQRLKNHRPFVPALEGVAFEYGFNTAQLESWLKYWAEEYPLRNGR 528 + S+L QR+++ + E E+G+ Q L W E P R R Sbjct: 49 IFSELIQRIQSQVSGIQEFEEKLNEHGYRVGQKLVELVVWRERNPKRETR 98 >SPAC6G10.08 |idp1||isocitrate dehydrogenase Idp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 418 Score = 24.6 bits (51), Expect = 9.4 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = +1 Query: 313 PNELNTKNDISIR---PFKIKFQEVMISDLKQRLK 408 P L+TKN I + FK FQEV SD KQ+ + Sbjct: 216 PLYLSTKNTILKKYDGRFKDTFQEVYESDYKQKFE 250 >SPAC1B3.10c |||SEL1 repeat protein, unknown biological role|Schizosaccharomyces pombe|chr 1|||Manual Length = 680 Score = 24.6 bits (51), Expect = 9.4 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -1 Query: 308 HHSLGSRVGGFDGPQINIYHTLIAM 234 H L ++ G D Q YH LIA+ Sbjct: 169 HWELAAKQGSLDAHQFLAYHNLIAL 193 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,979,241 Number of Sequences: 5004 Number of extensions: 36491 Number of successful extensions: 102 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 220420454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -