BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_L14 (533 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0059 + 7900544-7900673,7900774-7901027,7901949-7902320 28 5.4 02_05_0497 - 29502012-29502101,29502128-29502197,29502302-295024... 27 7.2 >05_03_0059 + 7900544-7900673,7900774-7901027,7901949-7902320 Length = 251 Score = 27.9 bits (59), Expect = 5.4 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 6/69 (8%) Frame = -1 Query: 395 FKSLIITSWNLILKGL--ILISFLVFSSFGPHHSLGSRVGGFDGPQINIYHT----LIAM 234 F+S + + L+ L IL+ +L P H+LGS +G G + I T + Sbjct: 101 FRSALYVAAQLLASSLACILLRYLTGGMATPVHTLGSGIGPMQGLVMEIILTFSLLFVVY 160 Query: 233 ATTLVPNSA 207 AT L P S+ Sbjct: 161 ATILDPRSS 169 >02_05_0497 - 29502012-29502101,29502128-29502197,29502302-29502411, 29502530-29502641,29503341-29503498,29503592-29503807, 29504127-29504354,29504722-29504801,29504886-29505056, 29505179-29505281,29505369-29505551,29506313-29506813, 29506935-29507100,29507517-29507566,29508047-29508127, 29508291-29508398,29508874-29508939,29509053-29509109, 29509442-29509507,29509917-29510006,29510850-29510975, 29511681-29511717,29512192-29512250,29512562-29512615, 29513294-29513428,29513542-29513612,29513720-29513957 Length = 1141 Score = 27.5 bits (58), Expect = 7.2 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +1 Query: 286 TLDPNEWWGPNELNTKND 339 T+D +EW+ P +L T+ND Sbjct: 473 TIDRHEWYAPPQLYTRND 490 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,443,593 Number of Sequences: 37544 Number of extensions: 226485 Number of successful extensions: 543 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 532 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1190246000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -