BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_L13 (577 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 26 1.0 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 5.4 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 7.1 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 23 7.1 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 9.4 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 25.8 bits (54), Expect = 1.0 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 264 PASSWKLVRVTRSSALGP*APMIPSRNPSTVV 359 PAS W+ VR+ R P ++ SR ST V Sbjct: 396 PASFWQFVRIRRGCNTLPNEMVLDSRTASTPV 427 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.4 bits (48), Expect = 5.4 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = +1 Query: 472 HHCQELRRLLGRNRISPRKGSKSL 543 HH Q+ ++++G+N + R S+ + Sbjct: 788 HHLQQQQQIVGKNTLYSRNSSERM 811 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.0 bits (47), Expect = 7.1 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = -1 Query: 391 MHLVGHGVIWFTTVEGLREGIIGAYGPSADDLVTLTS 281 ++ H V W G R GI+G + LVT S Sbjct: 457 LYQADHPVHWSPVFMGGRSGILGRESENRRKLVTTVS 493 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 23.0 bits (47), Expect = 7.1 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +1 Query: 205 KSWSFH*RGYQRQNTRRQNGRHPPGSSSG*QDRRHLDRKP 324 K W + R ++N++RQ+ + GSS+ H +P Sbjct: 315 KIWFQNRRMKNKKNSQRQSAQANSGSSNNSSSHSHSQAQP 354 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 22.6 bits (46), Expect = 9.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 101 PGAPPSACFDMIPGHAADV 157 PG P C D +PG A V Sbjct: 396 PGIPGPPCVDGLPGAAGPV 414 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 653,890 Number of Sequences: 2352 Number of extensions: 14683 Number of successful extensions: 39 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -