BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_L13 (577 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK131302-1|BAD18470.1| 626|Homo sapiens protein ( Homo sapiens ... 66 1e-10 Z85987-1|CAI42222.1| 961|Homo sapiens FYVE, RhoGEF and PH domai... 30 5.1 BC044311-1|AAH44311.2| 399|Homo sapiens hypothetical protein LO... 30 5.1 BC034530-1|AAH34530.1| 961|Homo sapiens FYVE, RhoGEF and PH dom... 30 5.1 AK128824-1|BAC87625.1| 706|Homo sapiens protein ( Homo sapiens ... 30 5.1 >AK131302-1|BAD18470.1| 626|Homo sapiens protein ( Homo sapiens cDNA FLJ16275 fis, clone NT2RI2027157, moderately similar to Mouse SDR2 mRNA. ). Length = 626 Score = 65.7 bits (153), Expect = 1e-10 Identities = 44/143 (30%), Positives = 70/143 (48%), Gaps = 5/143 (3%) Frame = +2 Query: 98 PPGAPPSACFDMIPGHAADVQTVPAPYTITTAVSSVKAGHSIDVVISGKTPEDKMAGILL 277 P G +C MIP H Q+VP + I + + + G I+V +SG G LL Sbjct: 24 PNGKVTQSCHGMIPEHGHSPQSVPV-HDIYVSQMTFRPGDQIEVTLSGHP----FKGFLL 78 Query: 278 EARQGDKI----VGTWTVSPDDTFSQPLNCGE-PNNAVTHKMHAKELDRQTVSYPWTAPK 442 EAR + + +G++T+ D SQ L C + +AV+H+ +K+ + + W AP Sbjct: 79 EARNAEDLNGPPIGSFTLI-DSEVSQLLTCEDIQGSAVSHRSASKKTE---IKVYWNAPS 134 Query: 443 DLEGDVVFKVTIVKSYAVFWVGI 511 F VT+V+ Y ++WV I Sbjct: 135 SAPNHTQFLVTVVEKYKIYWVKI 157 >Z85987-1|CAI42222.1| 961|Homo sapiens FYVE, RhoGEF and PH domain containing 1 (faciogenital dysplasia) protein. Length = 961 Score = 30.3 bits (65), Expect = 5.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 86 PALTPPGAPPSACFDMIPG 142 PA PPGA P AC D PG Sbjct: 18 PATNPPGAAPPACADSDPG 36 >BC044311-1|AAH44311.2| 399|Homo sapiens hypothetical protein LOC339344 protein. Length = 399 Score = 30.3 bits (65), Expect = 5.1 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +2 Query: 86 PALTPPGAPPSACFDMIPGHAADVQTVPAPYTITTAVSSVKAGHSIDVVISGKTPE 253 P L PP PP ++P A V+ P P ++ AV + V+I+ ++ E Sbjct: 308 PPLPPPPPPPPPPRPVLPPPAPKVEITPEPVSVVAAVVDGAVVAARGVIIAPRSEE 363 >BC034530-1|AAH34530.1| 961|Homo sapiens FYVE, RhoGEF and PH domain containing 1 (faciogenital dysplasia) protein. Length = 961 Score = 30.3 bits (65), Expect = 5.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +2 Query: 86 PALTPPGAPPSACFDMIPG 142 PA PPGA P AC D PG Sbjct: 18 PATNPPGAAPPACADSDPG 36 >AK128824-1|BAC87625.1| 706|Homo sapiens protein ( Homo sapiens cDNA FLJ46160 fis, clone TESTI4002141. ). Length = 706 Score = 30.3 bits (65), Expect = 5.1 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -3 Query: 320 LRSKCRRSCHPDELPGGCRPFCLRVFC 240 LR+ C P + GGC C+RV C Sbjct: 241 LRASVSECCVPGDAQGGCAGICVRVLC 267 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,579,607 Number of Sequences: 237096 Number of extensions: 2379876 Number of successful extensions: 8180 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8170 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5929224630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -