BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_L09 (544 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|c... 27 2.4 SPBPJ4664.06 |gpt1||UDP-glucose-glycoprotein glucosyltransferase... 25 5.5 >SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 288 Score = 26.6 bits (56), Expect = 2.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 46 CTREIKQVCGSDGVTYGNPCLLNCA 120 C R + + S+ V YG P LNCA Sbjct: 110 CERLLPYLVASNPVNYGRPWRLNCA 134 >SPBPJ4664.06 |gpt1||UDP-glucose-glycoprotein glucosyltransferase Gpt1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1448 Score = 25.4 bits (53), Expect = 5.5 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -3 Query: 383 IWFFYALQGSCVTTVKWSPPWHRIMHSLL*VTPFEAQTGSK 261 +++ AL+G C +++SPP ++S L V F K Sbjct: 185 LYYKLALEGKCNYVIRYSPPSSSKLNSKLYVKGFGTHVSLK 225 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,195,334 Number of Sequences: 5004 Number of extensions: 43119 Number of successful extensions: 102 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 223909422 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -