BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_L09 (544 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 38 9e-05 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 22 4.6 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 37.5 bits (83), Expect = 9e-05 Identities = 17/34 (50%), Positives = 18/34 (52%), Gaps = 3/34 (8%) Frame = +1 Query: 250 CTRNLEPVCASNGVTYNNECMMR---CHGGDHLT 342 C R PVCASNG Y N C + CH G LT Sbjct: 110 CPRRHRPVCASNGKIYANHCELHRAACHSGSSLT 143 Score = 29.9 bits (64), Expect = 0.018 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 5/52 (9%) Frame = +1 Query: 4 ECQEVKVADIQPCICTREI----KQVCGSDGVTYGNPCLLN-CATQSNPSLS 144 EC+ + I C+C R+ + VC S+G Y N C L+ A S SL+ Sbjct: 92 ECELSPNSTIAVCVCMRKCPRRHRPVCASNGKIYANHCELHRAACHSGSSLT 143 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.8 bits (44), Expect = 4.6 Identities = 10/31 (32%), Positives = 12/31 (38%) Frame = -1 Query: 187 PQPSLCCRKDPGVRCSSSGSTVWRNSTGTGC 95 P PS CR SGS +W+ C Sbjct: 47 PIPSYACRGRCSSYLQVSGSKIWQMERSCMC 77 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,204 Number of Sequences: 438 Number of extensions: 3437 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15459066 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -