BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_L09 (544 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g36490.1 68417.m05181 SEC14 cytosolic factor, putative / phos... 33 0.093 At5g40942.1 68418.m04973 ribonucleoside-diphosphate reductase sm... 31 0.50 At2g18180.1 68415.m02115 SEC14 cytosolic factor, putative / phos... 31 0.50 At2g31770.1 68415.m03879 zinc finger (C3HC4-type RING finger) fa... 31 0.66 At2g28830.1 68415.m03505 armadillo/beta-catenin repeat family pr... 30 1.1 At5g26920.1 68418.m03210 calmodulin-binding protein similar to c... 28 3.5 At4g28630.1 68417.m04093 ABC transporter family protein identica... 28 3.5 At3g14850.2 68416.m01876 expressed protein 28 3.5 At3g14850.1 68416.m01877 expressed protein 28 3.5 At5g58080.1 68418.m07268 two-component responsive regulator fami... 27 8.1 At3g51560.1 68416.m05646 disease resistance protein (TIR-NBS-LRR... 27 8.1 At2g39770.1 68415.m04883 GDP-mannose pyrophosphorylase (GMP1) i... 27 8.1 >At4g36490.1 68417.m05181 SEC14 cytosolic factor, putative / phosphoglyceride transfer protein, putative similar to phosphatidylinositol transfer-like protein IV (GI:14486707) [Lotus japonicus]; contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus; supporting cDNA gi|23463078|gb|BT000834.1| Length = 543 Score = 33.5 bits (73), Expect = 0.093 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Frame = +1 Query: 172 RVKVVENQPESNKVIVVDNNNAP-----SCACTRNLEPVCASNGVTYNNECMMRCHGGDH 336 ++ V+ N+ +S + ++D + P SC C N + + G N E M R H GDH Sbjct: 261 KIHVLGNKYQSKLLEIIDESELPEFLGGSCTCADNGGCMRSDKGPWKNPEIMKRVHNGDH 320 >At5g40942.1 68418.m04973 ribonucleoside-diphosphate reductase small chain, putative / ribonucleotide reductase, putative similar to ribonucleotide reductase R2 [Nicotiana tabacum] GI:1044912; contains Pfam profile PF00268: Ribonucleotide reductase, small chain Length = 231 Score = 31.1 bits (67), Expect = 0.50 Identities = 14/46 (30%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = -2 Query: 204 GFRLVFHNLHS-VVARTRVFDAQARVRLCGAIQQARVAVSDAVATA 70 GF++ N+HS ++ RT+ + + + +C A++ R V DA++ A Sbjct: 101 GFQIAIENIHSEILLRTKFDEDRLKAIVCDAVEIEREFVCDALSCA 146 >At2g18180.1 68415.m02115 SEC14 cytosolic factor, putative / phosphoglyceride transfer protein, putative contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminussimilar to phosphatidylinositol transfer-like protein IV (GI:14486707) [Lotus japonicus]; Length = 558 Score = 31.1 bits (67), Expect = 0.50 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 5/74 (6%) Frame = +1 Query: 172 RVKVVENQPESNKVIVVDNNNAP-----SCACTRNLEPVCASNGVTYNNECMMRCHGGDH 336 ++ V+ N+ +S + ++D + P SC C N + + G N + M R + GDH Sbjct: 264 KIHVLGNKYQSKLLEIIDASELPEFLGGSCTCADNGGCMRSDKGPWNNPDIMKRVNNGDH 323 Query: 337 LTVVTHEPCNA*KN 378 + + NA +N Sbjct: 324 ICSKRSQADNAGEN 337 >At2g31770.1 68415.m03879 zinc finger (C3HC4-type RING finger) family protein contains a Prosite:PS00518 Zinc finger, C3HC4 type (RING finger), signature and Pfam domain, PF01485: IBR domain Length = 543 Score = 30.7 bits (66), Expect = 0.66 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = +1 Query: 73 GSDGVTYGNPCLLNCATQSNPSLSIEHPGPCDNRVK-VVENQPESNKVIVVDNNNAPSCA 249 GS+ +Y CL + N S P CD K + +NQ ES + N+ P Sbjct: 230 GSESSSYDVSCLCSYRFCWNCSEDAHSPVDCDTVSKWIFKNQDESENKNWMLANSKPCPE 289 Query: 250 CTRNLEPVCASNGVTYNNEC 309 C R +E N +T + C Sbjct: 290 CKRPIEKNDGCNHMTCSAPC 309 >At2g28830.1 68415.m03505 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 654 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 265 EPVCASNGVTYNNECMMRCHGGDHLT 342 +PV S+G TY EC+ + G HLT Sbjct: 271 DPVIVSSGQTYERECIKKWLEGGHLT 296 >At5g26920.1 68418.m03210 calmodulin-binding protein similar to calmodulin-binding protein TCB60 GI:1698548 from [Nicotiana tabacum] Length = 492 Score = 28.3 bits (60), Expect = 3.5 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 196 VGFPQPSLCCRKDPGVRCSSSGS 128 VG PQ SL C +DPG + SGS Sbjct: 301 VGHPQRSLQCPQDPGFVVTCSGS 323 >At4g28630.1 68417.m04093 ABC transporter family protein identical to half-molecule ABC transporter ATM1 GI:9964117 from [Arabidopsis thaliana] Length = 678 Score = 28.3 bits (60), Expect = 3.5 Identities = 20/75 (26%), Positives = 31/75 (41%), Gaps = 3/75 (4%) Frame = -2 Query: 279 GTDWLQVSCTRTRRCIVVINDNNLIGFRLVFHNLH---SVVARTRVFDAQARVRLCGAIQ 109 G D +V+ R CI V+ + ++ +FHN+H V+DA R + I Sbjct: 498 GQDIKEVTLESLRSCIGVVPQDTVLFNDTIFHNIHYGNLSATEEEVYDAARRAVIHDTIM 557 Query: 108 QARVAVSDAVATANL 64 + S AV L Sbjct: 558 KFPDKYSTAVGERGL 572 >At3g14850.2 68416.m01876 expressed protein Length = 321 Score = 28.3 bits (60), Expect = 3.5 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 82 GVTYGNPCLLNCATQSNPSLSIEHPGPCDNRVKVVE 189 GV +G P +C Q P L ++PG V V++ Sbjct: 223 GVLWGEPAAKSCVGQKEPLLGTKYPGGLPAEVGVLK 258 >At3g14850.1 68416.m01877 expressed protein Length = 253 Score = 28.3 bits (60), Expect = 3.5 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 82 GVTYGNPCLLNCATQSNPSLSIEHPGPCDNRVKVVE 189 GV +G P +C Q P L ++PG V V++ Sbjct: 155 GVLWGEPAAKSCVGQKEPLLGTKYPGGLPAEVGVLK 190 >At5g58080.1 68418.m07268 two-component responsive regulator family protein / response regulator family protein contains Pfam profile: PF00072 response regulator receiver domain Length = 581 Score = 27.1 bits (57), Expect = 8.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 112 NCATQSNPSLSIEHPGPCDNRV 177 NC +NP +IE+P P DN V Sbjct: 477 NCTMLNNPFGNIEYPLPADNMV 498 >At3g51560.1 68416.m05646 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1253 Score = 27.1 bits (57), Expect = 8.1 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -3 Query: 83 PSLPQTCLISRVQIHGCISATLTSW 9 P+LPQ+ + + +HGC+S SW Sbjct: 983 PALPQS--LKLLNVHGCVSLESVSW 1005 >At2g39770.1 68415.m04883 GDP-mannose pyrophosphorylase (GMP1) identical to GDP-mannose pyrophosphorylase from Arabidopsis thaliana [GI:3598958]; updated per Conklin PL et al, PNAS 1999, 96(7):4198-203 Length = 361 Score = 27.1 bits (57), Expect = 8.1 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 53 RVQIHGCISATLTSWHS 3 R++ H CIS+++ WHS Sbjct: 297 RIKKHACISSSIIGWHS 313 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,551,423 Number of Sequences: 28952 Number of extensions: 232817 Number of successful extensions: 618 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 617 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1013649368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -