BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_L06 (367 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC14F5.04c |pgk1||phosphoglycerate kinase|Schizosaccharomyces ... 42 2e-05 SPCC663.15c |||conserved fungal protein|Schizosaccharomyces pomb... 27 0.69 SPAC26H5.11 |||spore wall assembly protein |Schizosaccharomyces ... 26 1.6 SPCC63.10c |||dolichol kinase |Schizosaccharomyces pombe|chr 3||... 25 3.7 SPAC2F3.08 |sut1||alpha-glucoside transporter |Schizosaccharomyc... 24 6.4 >SPBC14F5.04c |pgk1||phosphoglycerate kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 414 Score = 42.3 bits (95), Expect = 2e-05 Identities = 25/53 (47%), Positives = 33/53 (62%) Frame = +3 Query: 204 ITNNQRIIAAPESLKYALEKSAQSICI*ESHLSRTKWATKFKVQPLKPVAEEL 362 ITNN RI+ A ++KYALE+ +++ + SHL R A K LKPVA EL Sbjct: 34 ITNNARIVGALPTIKYALEQQPKAVIL-MSHLGRPNGARVAKYS-LKPVAAEL 84 >SPCC663.15c |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 657 Score = 27.5 bits (58), Expect = 0.69 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = -2 Query: 165 SITTSLVGLNVEDASMREFSHEPFLQRIVKRLNVYYLLIIY 43 S+ SL +N++DA+ E H P VKRL Y L++Y Sbjct: 134 SVQKSLANVNMDDANGPERLHYP----SVKRLREAYSLLVY 170 >SPAC26H5.11 |||spore wall assembly protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 965 Score = 26.2 bits (55), Expect = 1.6 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 113 SRIDASSTFSPTSEVVMLSRTSTIPLQRRS 202 +R + TF T ++ LSRTST+ L S Sbjct: 431 TRPHTNETFVTTDDITQLSRTSTLSLSTAS 460 >SPCC63.10c |||dolichol kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 465 Score = 25.0 bits (52), Expect = 3.7 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 3 VLMFTSIPFSCILYI*LRDNKHLTFSLSSAEMA 101 +L +S PF CILY+ +N L + + EMA Sbjct: 79 LLWLSSFPF-CILYVGFGENSVLYHEMYTMEMA 110 >SPAC2F3.08 |sut1||alpha-glucoside transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 553 Score = 24.2 bits (50), Expect = 6.4 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -1 Query: 88 EDSEKVKCLLSLNYIYNMQENGMLVNIRT 2 ED E+ + + N YN+QE L NIRT Sbjct: 347 EDDEEDESSDASNNEYNIQERNDLGNIRT 375 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,478,632 Number of Sequences: 5004 Number of extensions: 25389 Number of successful extensions: 58 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 114084208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -