BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_L06 (367 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_86| Best HMM Match : PGK (HMM E-Value=0) 47 5e-06 SB_49244| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_55989| Best HMM Match : zf-C2H2 (HMM E-Value=8e-08) 27 4.7 SB_8459| Best HMM Match : DUF408 (HMM E-Value=0.62) 27 4.7 >SB_86| Best HMM Match : PGK (HMM E-Value=0) Length = 445 Score = 46.8 bits (106), Expect = 5e-06 Identities = 27/54 (50%), Positives = 35/54 (64%) Frame = +3 Query: 204 ITNNQRIIAAPESLKYALEKSAQSICI*ESHLSRTKWATKFKVQPLKPVAEELK 365 ITNNQRI+AA S+K+ LEK A+S+ + SHL R + K + PVA ELK Sbjct: 33 ITNNQRIVAALPSIKHCLEKGAKSVVL-MSHLGRPDGRVQEKYS-MAPVANELK 84 >SB_49244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 28.7 bits (61), Expect = 1.5 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = -1 Query: 88 EDSEKVKCLLSLNYIYNMQENGMLVNI 8 E S KV CL SLN + NM+ +LVN+ Sbjct: 413 EGSCKVVCLSSLNILENMKLGSILVNL 439 >SB_55989| Best HMM Match : zf-C2H2 (HMM E-Value=8e-08) Length = 1011 Score = 27.1 bits (57), Expect = 4.7 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -1 Query: 271 CALFSKAYFSDSGAAIMR*LFVITP 197 C S AYFSDS I + LF TP Sbjct: 251 CRSSSSAYFSDSAPEISQDLFSFTP 275 >SB_8459| Best HMM Match : DUF408 (HMM E-Value=0.62) Length = 581 Score = 27.1 bits (57), Expect = 4.7 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -1 Query: 271 CALFSKAYFSDSGAAIMR*LFVITP 197 C S AYFSDS I + LF TP Sbjct: 320 CRSSSSAYFSDSAPEISQDLFSFTP 344 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,669,877 Number of Sequences: 59808 Number of extensions: 174070 Number of successful extensions: 332 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 332 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 582596255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -