BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_L06 (367 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 0.89 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 22 6.3 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 22 8.3 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 25.0 bits (52), Expect = 0.89 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 189 RGIVEVLLSITTSLVGLNVEDASMREFSHEP 97 R ++ ++S T L NV+D E SHEP Sbjct: 78 RSLLSSMVSNLTDLQVANVDDVEDSEGSHEP 108 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 22.2 bits (45), Expect = 6.3 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 150 LVGLNVEDASMREFSHEPFLQRIVKRLNVY 61 LVG + + ++ EPF RI RL+ Y Sbjct: 187 LVGTDPLSSPLQAAPREPFTDRIWIRLSAY 216 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 21.8 bits (44), Expect = 8.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 293 SLKPNQMGNQI*STTPKAGS 352 S+KP M N+ S TPK+ S Sbjct: 290 SIKPTPMLNRSMSQTPKSSS 309 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 371,237 Number of Sequences: 2352 Number of extensions: 5508 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 27514560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -