BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_L04 (244 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1306.01c ||SPBC409.22c|translation elongation factor G|Schiz... 25 1.4 SPBC1347.10 |cdc23|mcm10|MCM-associated protein Mcm10|Schizosacc... 23 7.5 >SPBC1306.01c ||SPBC409.22c|translation elongation factor G|Schizosaccharomyces pombe|chr 2|||Manual Length = 770 Score = 25.0 bits (52), Expect = 1.4 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +2 Query: 113 RLFVLCLAGGEIGGHRYYGYGVTTQDGAFHPATPSQL 223 + F L G + GH +DGA+HP S+L Sbjct: 617 KAFYEALKKGFLIGHPIKNCRFVLEDGAYHPVDSSEL 653 >SPBC1347.10 |cdc23|mcm10|MCM-associated protein Mcm10|Schizosaccharomyces pombe|chr 2|||Manual Length = 593 Score = 22.6 bits (46), Expect = 7.5 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -3 Query: 155 VPRSPPQQDR 126 VPRSPPQQ R Sbjct: 49 VPRSPPQQVR 58 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 591,227 Number of Sequences: 5004 Number of extensions: 7844 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 2,362,478 effective HSP length: 59 effective length of database: 2,067,242 effective search space used: 43412082 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -