BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= I10A02NGRL0006_L04
(244 letters)
Database: spombe
5004 sequences; 2,362,478 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SPBC1306.01c ||SPBC409.22c|translation elongation factor G|Schiz... 25 1.4
SPBC1347.10 |cdc23|mcm10|MCM-associated protein Mcm10|Schizosacc... 23 7.5
>SPBC1306.01c ||SPBC409.22c|translation elongation factor
G|Schizosaccharomyces pombe|chr 2|||Manual
Length = 770
Score = 25.0 bits (52), Expect = 1.4
Identities = 12/37 (32%), Positives = 17/37 (45%)
Frame = +2
Query: 113 RLFVLCLAGGEIGGHRYYGYGVTTQDGAFHPATPSQL 223
+ F L G + GH +DGA+HP S+L
Sbjct: 617 KAFYEALKKGFLIGHPIKNCRFVLEDGAYHPVDSSEL 653
>SPBC1347.10 |cdc23|mcm10|MCM-associated protein
Mcm10|Schizosaccharomyces pombe|chr 2|||Manual
Length = 593
Score = 22.6 bits (46), Expect = 7.5
Identities = 9/10 (90%), Positives = 9/10 (90%)
Frame = -3
Query: 155 VPRSPPQQDR 126
VPRSPPQQ R
Sbjct: 49 VPRSPPQQVR 58
Database: spombe
Posted date: Oct 4, 2007 10:57 AM
Number of letters in database: 2,362,478
Number of sequences in database: 5004
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 591,227
Number of Sequences: 5004
Number of extensions: 7844
Number of successful extensions: 15
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 2,362,478
effective HSP length: 59
effective length of database: 2,067,242
effective search space used: 43412082
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -