BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_L03 (461 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0834 - 11630288-11630500,11630531-11630623,11630844-116310... 33 0.15 09_06_0147 + 21195222-21195377,21195471-21195522,21196842-212043... 27 9.7 >03_02_0834 - 11630288-11630500,11630531-11630623,11630844-11631050, 11631301-11633089,11633817-11634145 Length = 876 Score = 32.7 bits (71), Expect = 0.15 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 4/73 (5%) Frame = +1 Query: 247 ESHDELLKAIDFPNDNVTKAVFTDLNQKVRSI--KGVDLKLANKVYIANGNELNDQFAVV 420 + HD LLK+ NDN+TK + NQ + + KG D K +KV N+Q + Sbjct: 467 KEHDTLLKSSVELNDNLTKTA-EERNQILECLKEKGGDNKALHKVIARLQRISNEQEKTI 525 Query: 421 S--RDVFNSEVQN 453 + R FN+E++N Sbjct: 526 TGLRQGFNAELEN 538 >09_06_0147 + 21195222-21195377,21195471-21195522,21196842-21204362, 21204453-21205031,21205176-21205484,21205638-21205718, 21205971-21206279,21207430-21207816,21207964-21208767, 21208856-21209218,21209437-21209667,21209934-21210278, 21210494-21210712,21210759-21210815,21210978-21211322, 21211538-21211756,21211803-21211859,21212022-21212366, 21212584-21212814,21213100-21213458 Length = 4322 Score = 26.6 bits (56), Expect = 9.7 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +2 Query: 14 ETRKSPTP*QHYNNHYSPSRX*HWPVTSTHKEYSRMEMINSPH 142 ++RK PTP Y + PS+ P + ++ S+ E+ PH Sbjct: 2609 DSRKPPTPDTQYASQIIPSQEKVAPDVPSQEKVSQAELSLKPH 2651 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,217,033 Number of Sequences: 37544 Number of extensions: 169949 Number of successful extensions: 410 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 410 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 919380308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -