BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_K20 (505 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 22 3.2 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 22 4.2 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 22 4.2 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 4.2 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 5.5 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 5.5 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 5.5 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 21 5.5 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 5.5 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 7.3 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 7.3 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 21 9.6 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 9.6 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 22.2 bits (45), Expect = 3.2 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = -1 Query: 445 LVEGHNLSEIVNESNE 398 ++ G L+EI+NE++E Sbjct: 45 IINGKKLTEIINETHE 60 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 21.8 bits (44), Expect = 4.2 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -1 Query: 232 IIHFTLDEINCHVRVHIIIGFTDSHLDRIVFIHRVIT 122 I+ F L I C + + D +DRI+ R++T Sbjct: 5 ILLFVLVTITCVIAEDYTTKYDDMDIDRILQNGRILT 41 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 21.8 bits (44), Expect = 4.2 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -1 Query: 232 IIHFTLDEINCHVRVHIIIGFTDSHLDRIVFIHRVIT 122 I+ F L I C + + D +DRI+ R++T Sbjct: 5 ILLFVLVTITCVIAEDYTTKYDDMDIDRILQNGRILT 41 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 4.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 37 TRIPGVRYGPVASTPTRG 90 T + GV Y PV TP+ G Sbjct: 838 TTMAGVIYPPVIGTPSTG 855 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 5.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 495 HLHPTANVSPTTHHSGSS*KAITFPRS*MSPM 400 H+ T+N HHSGS ++I + PM Sbjct: 109 HIATTSNEFIRIHHSGSITRSIRLTITASCPM 140 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 5.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 495 HLHPTANVSPTTHHSGSS*KAITFPRS*MSPM 400 H+ T+N HHSGS ++I + PM Sbjct: 109 HIATTSNEFIRIHHSGSITRSIRLTITASCPM 140 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 5.5 Identities = 7/19 (36%), Positives = 16/19 (84%) Frame = +2 Query: 251 FKSTIKDALIKLNDLVDES 307 FK+ ++ LIK++D+++E+ Sbjct: 221 FKNLPEETLIKISDVLEET 239 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 21.4 bits (43), Expect = 5.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 495 HLHPTANVSPTTHHSGSS*KAITFPRS*MSPM 400 H+ T+N HHSGS ++I + PM Sbjct: 48 HIATTSNEFIRIHHSGSITRSIRLTITASCPM 79 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 5.5 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 197 MTVDFVKGKMDN 232 M+VDF+KG + N Sbjct: 184 MSVDFIKGSISN 195 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.0 bits (42), Expect = 7.3 Identities = 11/44 (25%), Positives = 20/44 (45%) Frame = +2 Query: 8 KWTRENMKIKPESPVSVMDPSLLLRPEEKYEDKPLEAFRDYTVD 139 K E++ + + DP + L +E E L+ ++YT D Sbjct: 178 KLQMESLSHTTDEMIFQWDPDVPLVVDENIELPQLQLVKNYTAD 221 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 7.3 Identities = 18/71 (25%), Positives = 29/71 (40%) Frame = +2 Query: 269 DALIKLNDLVDESDPDTNLPNIVHAFQTAERIREDHPDDDWFHLIGLIHDLGKVMAFYEE 448 D KLN+ +D++D N P + F+ + +D DL FYE+ Sbjct: 1383 DVRAKLNEYLDKADVIVNTPIMDAHFKDVKLSDFGFSTEDILDTAD--EDLLINNVFYED 1440 Query: 449 PEWCVVGDTFA 481 C++ T A Sbjct: 1441 ETSCMLDKTRA 1451 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 296 VDESDPDTNLPNIVHA 343 +D+SDPD + VH+ Sbjct: 119 IDDSDPDPSSEPTVHS 134 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 296 VDESDPDTNLPNIVHA 343 +D+SDPD + VH+ Sbjct: 567 IDDSDPDPSSEPTVHS 582 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,031 Number of Sequences: 438 Number of extensions: 3151 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13864083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -