BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_K20 (505 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g14520.1 68414.m01721 oxygenase-related similar to myo-inosit... 127 5e-30 At2g19800.1 68415.m02313 expressed protein similar to myo-inosit... 120 6e-28 At5g56640.1 68418.m07071 expressed protein similar to myo-inosit... 119 1e-27 At4g26260.1 68417.m03779 expressed protein similar to myo-inosit... 118 3e-27 At1g03760.1 68414.m00356 prefoldin subunit family protein contai... 28 3.1 At5g21900.1 68418.m02539 expressed protein 28 4.1 At2g42955.1 68415.m05326 hypothetical protein 28 4.1 At1g29470.1 68414.m03605 dehydration-responsive protein-related ... 28 4.1 At5g08240.1 68418.m00967 expressed protein 27 5.4 At2g04660.1 68415.m00475 E3 ubiquitin ligase, putative E3, ubiqu... 27 5.4 At5g66630.1 68418.m08398 LIM domain-containing protein contains ... 27 9.5 >At1g14520.1 68414.m01721 oxygenase-related similar to myo-inositol oxygenase [Sus scrofa] gi|17432544|gb|AAL39076 Length = 311 Score = 127 bits (306), Expect = 5e-30 Identities = 63/132 (47%), Positives = 82/132 (62%), Gaps = 3/132 (2%) Frame = +2 Query: 119 FRDYTVDENDPIKMRVRKTYYDMHTNMTVDFVKGKMDNWLKFNHFKSTIKDALIKLNDLV 298 FRDY D + V + Y H TVDFV+ + + K N + +I + LN+ + Sbjct: 51 FRDY--DAESERRRGVEEFYRVNHIGQTVDFVRKMREEYEKLNRTEMSIWECCELLNEFI 108 Query: 299 DESDPDTNLPNIVHAFQTAERIREDHPDDDWFHLIGLIHDLGKVM---AFYEEPEWCVVG 469 DESDPD + P I H QTAE IR+D+PD+DW HL GLIHDLGKV+ +F E P+W VVG Sbjct: 109 DESDPDLDEPQIEHLLQTAEAIRKDYPDEDWLHLTGLIHDLGKVLLHSSFGELPQWAVVG 168 Query: 470 DTFAVGCKWGKS 505 DTF VGC + +S Sbjct: 169 DTFPVGCAFDES 180 >At2g19800.1 68415.m02313 expressed protein similar to myo-inositol oxygenase [Sus scrofa] gi|17432544|gb|AAL39076 Length = 317 Score = 120 bits (289), Expect = 6e-28 Identities = 61/128 (47%), Positives = 78/128 (60%), Gaps = 3/128 (2%) Frame = +2 Query: 116 AFRDYTVDENDPIKMRVRKTYYDMHTNMTVDFVKGKMDNWLKFNHFKSTIKDALIKLNDL 295 +FRDY E++ + V + Y H + T DFVK + K N + +I + LN++ Sbjct: 55 SFRDYENGESER-QQGVEEFYRMQHIHQTYDFVKKMRKEYGKLNKMEMSIWECCELLNNV 113 Query: 296 VDESDPDTNLPNIVHAFQTAERIREDHPDDDWFHLIGLIHDLGKVMAFYE---EPEWCVV 466 VDESDPD + P I H QTAE IR D+PD+DW HL LIHDLGKV+ E P+W VV Sbjct: 114 VDESDPDLDEPQIQHLLQTAEAIRRDYPDEDWLHLTALIHDLGKVLLLPEFGGLPQWAVV 173 Query: 467 GDTFAVGC 490 GDTF VGC Sbjct: 174 GDTFPVGC 181 >At5g56640.1 68418.m07071 expressed protein similar to myo-inositol oxygenase [Sus scrofa] gi|17432544|gb|AAL39076 Length = 314 Score = 119 bits (287), Expect = 1e-27 Identities = 67/159 (42%), Positives = 88/159 (55%), Gaps = 3/159 (1%) Frame = +2 Query: 38 PESPVSVMDPSLLLRPEEKYEDKPLEAFRDYTVDENDPIKMRVRKTYYDMHTNMTVDFVK 217 P S +S D + L PE + FRDYT D N + V Y HTN T+DFV+ Sbjct: 30 PMSKIS-SDDEVFLAPEMNAFGRQ---FRDYT-DTNSERQKSVEHFYATQHTNQTLDFVQ 84 Query: 218 GKMDNWLKFNHFKSTIKDALIKLNDLVDESDPDTNLPNIVHAFQTAERIREDHPDDDWFH 397 + K + I + ++VDESDPD + P I H Q+AE IR+D+P++DW H Sbjct: 85 KMRSEYGKLDKMVMNIWECCELSKEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLH 144 Query: 398 LIGLIHDLGKVMA---FYEEPEWCVVGDTFAVGCKWGKS 505 L LIHDLGKV+ F P+W VVGDTF VGC + +S Sbjct: 145 LTALIHDLGKVLTLPQFGGLPQWAVVGDTFPVGCAFDES 183 >At4g26260.1 68417.m03779 expressed protein similar to myo-inositol oxygenase [Sus scrofa] gi|17432544|gb|AAL39076 Length = 317 Score = 118 bits (283), Expect = 3e-27 Identities = 61/132 (46%), Positives = 80/132 (60%), Gaps = 3/132 (2%) Frame = +2 Query: 119 FRDYTVDENDPIKMRVRKTYYDMHTNMTVDFVKGKMDNWLKFNHFKSTIKDALIKLNDLV 298 FRDY V+ + V + Y H N TVDFVK + K + +I + LN++V Sbjct: 57 FRDYDVESER--QKGVEEFYRLQHINQTVDFVKKMRAEYGKLDKMVMSIWECCELLNEVV 114 Query: 299 DESDPDTNLPNIVHAFQTAERIREDHPDDDWFHLIGLIHDLGKVMA---FYEEPEWCVVG 469 DESDPD + P I H Q+AE IR+D+P++DW HL LIHDLGKV+ F P+W VVG Sbjct: 115 DESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVITLPQFGGLPQWAVVG 174 Query: 470 DTFAVGCKWGKS 505 DTF VGC + +S Sbjct: 175 DTFPVGCAFDES 186 >At1g03760.1 68414.m00356 prefoldin subunit family protein contains similarity to Swiss-Prot:O94763 RNA polymerase II subunit 5-mediating protein (RPB5-mediating protein) [Homo sapiens]; contains Pfam profile PF02996: Prefoldin subunit Length = 391 Score = 28.3 bits (60), Expect = 3.1 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = +2 Query: 86 EEKYEDKPLEAFR-DYTVDENDPIKMRVRKTYYDMHTNMTVDFVKGKM 226 EEK +K +E R VDEND + V+K +H N+ V F GKM Sbjct: 27 EEKIGEKRVEMNRLQQYVDENDNLINLVKKLPDQLHHNVMVPF--GKM 72 >At5g21900.1 68418.m02539 expressed protein Length = 544 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -2 Query: 321 LVSGSDSSTKSFSLMRASFIVDLKWLNFNQLS 226 LVS +D +SF + R+S + DL N N+++ Sbjct: 345 LVSVNDGVVRSFFMFRSSILTDLSLANCNEVT 376 >At2g42955.1 68415.m05326 hypothetical protein Length = 213 Score = 27.9 bits (59), Expect = 4.1 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -1 Query: 346 ESVHNVRQVSVRIGFIDQIVQLDESILYCRLEVVEFQPI 230 + HNVR + DQ+V LD+ IL + V F+P+ Sbjct: 78 QEFHNVRSRPTHATYADQLVNLDDQILPWK---VHFRPV 113 >At1g29470.1 68414.m03605 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 770 Score = 27.9 bits (59), Expect = 4.1 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 3/102 (2%) Frame = +2 Query: 38 PES-PVSVMDPSLLLRPEEKYEDKPLEAFRDYTVDENDPIKMRVRKTYYDMHTNMTVD-- 208 PES P V L +E KP + D+T D ++ K V K+Y + M +D Sbjct: 563 PESWPERVETVPQWLDSQEGVYGKPAQ--EDFTAD-HERWKTIVSKSYLN---GMGIDWS 616 Query: 209 FVKGKMDNWLKFNHFKSTIKDALIKLNDLVDESDPDTNLPNI 334 +V+ MD + F + +KD + + ++V PDT LP I Sbjct: 617 YVRNVMDMRAVYGGFAAALKDLKLWVMNVVPIDSPDT-LPII 657 >At5g08240.1 68418.m00967 expressed protein Length = 258 Score = 27.5 bits (58), Expect = 5.4 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = +2 Query: 5 SKWTRENMKIKPESPVSVMDPSLLLRPEEKYEDKPLEAFRDYTVDENDPI 154 SK+ +N +IKP P+ + E + KPL R T +N P+ Sbjct: 58 SKFRLKNSEIKPSPIEETEKPTSRVEDETDDKQKPLSVIRRITDRKNIPV 107 >At2g04660.1 68415.m00475 E3 ubiquitin ligase, putative E3, ubiquitin ligase; contains similarity to anaphase-promoting complex subunit 2 GI:6180009 from [Homo sapiens] Length = 865 Score = 27.5 bits (58), Expect = 5.4 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Frame = +2 Query: 164 VRKTYYDMHTNM-TVDFVKGKMDNWLKFNHFKSTIKDALIKLNDLVDESDPDTNLPNIVH 340 + KT YD+ T + TV+ LK + +++++ I LNDL+D +T NI Sbjct: 566 LNKTDYDIDTEIRTVEL--------LKIHFGEASMQRCEIMLNDLIDSKRVNT---NIKK 614 Query: 341 AFQTAERIRED 373 A QT +RE+ Sbjct: 615 ASQTGAELREN 625 >At5g66630.1 68418.m08398 LIM domain-containing protein contains low similarity to Pfam profile PF00412: LIM domain Length = 702 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 23 NMKIKPESPVSVMDPSLLLRPEEKYEDKPLEAFRDYTVDE 142 NMKI+ E P+ ++ LL + EEK ++ R Y + E Sbjct: 490 NMKIEKEFPLILVRKELLNKKEEKIDNHYEVLIRAYCMSE 529 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,871,720 Number of Sequences: 28952 Number of extensions: 250521 Number of successful extensions: 746 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 742 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 898188928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -