BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_K19 (390 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 46 2e-07 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 25 0.23 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 25 0.23 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.23 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 5.0 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 21 6.6 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 21 6.6 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 6.6 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 6.6 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 6.6 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 6.6 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 21 6.6 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 6.6 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 6.6 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 6.6 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 6.6 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 6.6 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 6.6 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 6.6 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 6.6 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 6.6 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 6.6 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 6.6 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 6.6 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 6.6 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 6.6 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 6.6 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 6.6 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 6.6 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 6.6 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 6.6 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 6.6 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 6.6 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 6.6 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 6.6 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 6.6 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 6.6 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 6.6 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 6.6 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 6.6 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 6.6 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 6.6 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 6.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 20 8.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 20 8.7 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 20 8.7 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 20 8.7 AF213011-1|AAG43567.1| 62|Apis mellifera esterase A2 protein. 20 8.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 20 8.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 20 8.7 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 46.0 bits (104), Expect = 2e-07 Identities = 34/128 (26%), Positives = 57/128 (44%), Gaps = 1/128 (0%) Frame = +2 Query: 2 DISILFLKSPMEMTPNVGVVCLPLKDE-PAMPGTRCIAMGWGKDKFGKEGRHQTILKKVE 178 DI++L + ++ VG CLP + + G+ +GWG F G IL+K Sbjct: 257 DIALLKTEKDIKFGDKVGPACLPFQHFLDSFAGSDVTVLGWGHTSFN--GMLSHILQKTT 314 Query: 179 VPVVNRNTCMNKLQTTILGSLFYLHESFMCAGGEPGKDTCKGDGGSPLVCPMEYEDNRYV 358 + ++ + C ++ + MCA + GKD C+ D G P++ R V Sbjct: 315 LNMLTQVECYKYYGNIMVNA--------MCAYAK-GKDACQMDSGGPVLW-QNPRTKRLV 364 Query: 359 QNGIVTWG 382 GI++WG Sbjct: 365 NIGIISWG 372 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 25.4 bits (53), Expect = 0.23 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 149 DLPFRTCPSPNPWQCNVC 96 DLP+RTC NPW C Sbjct: 133 DLPWRTC--GNPWNTRYC 148 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 25.4 bits (53), Expect = 0.23 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 149 DLPFRTCPSPNPWQCNVC 96 DLP+RTC NPW C Sbjct: 186 DLPWRTC--GNPWNTRYC 201 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 25.4 bits (53), Expect = 0.23 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 321 KGEPPSPLQVSLPGSPP 271 +G PP+P Q PG PP Sbjct: 36 RGSPPNPSQGPPPGGPP 52 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 5.0 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VPIY+GNF Sbjct: 342 VPIYYGNF 349 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 131 VPVYYGNF 138 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 131 VPVYYGNF 138 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 116 VPVYYGNF 123 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 116 VPVYYGNF 123 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 116 VPVYYGNF 123 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 116 VPVYYGNF 123 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 116 VPVYYGNF 123 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 116 VPVYYGNF 123 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 119 VPVYYGNF 126 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 119 VPVYYGNF 126 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 119 VPVYYGNF 126 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 119 VPVYYGNF 126 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 122 VPVYYGNF 129 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 122 VPVYYGNF 129 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 122 VPVYYGNF 129 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 122 VPVYYGNF 129 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 131 VPVYYGNF 138 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 121 VPVYYGNF 128 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 126 VPVYYGNF 133 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 126 VPVYYGNF 133 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 126 VPVYYGNF 133 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 92 VPVYYGNF 99 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 92 VPVYYGNF 99 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 92 VPVYYGNF 99 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 92 VPVYYGNF 99 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 92 VPVYYGNF 99 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 92 VPVYYGNF 99 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 92 VPVYYGNF 99 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 341 VPVYYGNF 348 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 341 VPVYYGNF 348 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 341 VPVYYGNF 348 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 341 VPVYYGNF 348 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 341 VPVYYGNF 348 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 341 VPVYYGNF 348 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 356 VPVYYGNF 363 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 325 VPVYYGNF 332 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 341 VPVYYGNF 348 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 20.6 bits (41), Expect = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = -3 Query: 199 VPIYHGNF 176 VP+Y+GNF Sbjct: 352 VPVYYGNF 359 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 20.2 bits (40), Expect = 8.7 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 248 GRTSFPVSLSEAYSYMCSDLPRELPPFL 165 GRT+ + + +Y +L REL P+L Sbjct: 1155 GRTAQLIIVQAENAYPEVELDRELRPYL 1182 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 20.2 bits (40), Expect = 8.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 220 DNDTGKLVLPARVLHVR 270 D D LVLP+ LH+R Sbjct: 152 DYDGKYLVLPSGELHIR 168 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 20.2 bits (40), Expect = 8.7 Identities = 6/15 (40%), Positives = 9/15 (60%) Frame = +2 Query: 245 YLHESFMCAGGEPGK 289 Y+H+ + C PGK Sbjct: 478 YVHDEYTCMDCGPGK 492 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 20.2 bits (40), Expect = 8.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 88 YAWHTLHCHGLGEGQVR 138 +AW L G+GEG R Sbjct: 616 FAWGVLLNSGIGEGTPR 632 >AF213011-1|AAG43567.1| 62|Apis mellifera esterase A2 protein. Length = 62 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 210 FIHVFRFTTGTSTFFNM 160 ++H F +GTS+F M Sbjct: 23 YVHEGAFISGTSSFHEM 39 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 20.2 bits (40), Expect = 8.7 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = -3 Query: 253 VQVEQASQYRCLKLIHTCVPIYHGNF 176 V V QY + +I P ++GN+ Sbjct: 658 VHVTNMDQYNSILMIEHLSPDHNGNY 683 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.2 bits (40), Expect = 8.7 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -1 Query: 312 PPSPLQVSLPGS 277 PP+PL +S GS Sbjct: 1397 PPTPLSISRAGS 1408 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,553 Number of Sequences: 438 Number of extensions: 3551 Number of successful extensions: 50 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9514659 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -