BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_K16 (257 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-15|CAD27766.1| 56|Anopheles gambiae putative ribosoma... 113 8e-28 U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase... 23 1.4 AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. 22 4.2 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 21 5.6 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 21 9.8 CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase ... 21 9.8 AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant r... 21 9.8 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 21 9.8 >AJ439060-15|CAD27766.1| 56|Anopheles gambiae putative ribosomal protein protein. Length = 56 Score = 113 bits (273), Expect = 8e-28 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = +3 Query: 45 MGHANIWYSHPRRYGQGSRSCRACSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 212 MG AN+WYSHPR+YGQGSR RACSN HG+IRKYGLNICRQCFREYA DIGF+KLD Sbjct: 1 MGFANLWYSHPRKYGQGSRFWRACSNNHGMIRKYGLNICRQCFREYAKDIGFRKLD 56 >U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase protein. Length = 250 Score = 23.4 bits (48), Expect = 1.4 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -2 Query: 196 PISCAYSRKHCLQIFK 149 P++CA K+C + FK Sbjct: 82 PVNCALDPKYCFKTFK 97 >AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. Length = 115 Score = 21.8 bits (44), Expect = 4.2 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 121 FEQARHEREPCPYLRGC 71 F + + REP PY+ C Sbjct: 65 FCECKETREPLPYMYAC 81 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 21.4 bits (43), Expect = 5.6 Identities = 10/37 (27%), Positives = 14/37 (37%) Frame = -2 Query: 166 CLQIFKPYLRMRPCLFEQARHEREPCPYLRGCEYQIF 56 CL +++ R C H C GC +IF Sbjct: 356 CLSDSAIFVQSRNCNHHHGFHPSTVCKIPPGCSLKIF 392 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 20.6 bits (41), Expect = 9.8 Identities = 8/30 (26%), Positives = 12/30 (40%) Frame = +3 Query: 39 YIMGHANIWYSHPRRYGQGSRSCRACSNRH 128 Y+ G +W S +G CR +H Sbjct: 62 YLFGMEGVWCSTDGAHGLMLWFCRTARTKH 91 >CR954257-8|CAJ14159.1| 562|Anopheles gambiae putative esterase protein. Length = 562 Score = 20.6 bits (41), Expect = 9.8 Identities = 8/34 (23%), Positives = 15/34 (44%) Frame = -3 Query: 147 HIYE*DHVCLSRLGMNGNPARIYVGVNTRYLRDP 46 H + H ++ + NG ++ + RY DP Sbjct: 523 HYMDIGHDLVTGVNPNGQRTAVWRDLEARYANDP 556 >AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant receptor Or4 protein. Length = 397 Score = 20.6 bits (41), Expect = 9.8 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = +3 Query: 51 HANIWYSHPRRYGQGSRSCRACSNRHGLI 137 +A WY++P + R S RH I Sbjct: 333 YATRWYNYPIAFRSSIRMMLRQSQRHAHI 361 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 20.6 bits (41), Expect = 9.8 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -3 Query: 183 HTLGSTACRYSSHI 142 H+LG +CRY I Sbjct: 265 HSLGQRSCRYFGKI 278 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 291,028 Number of Sequences: 2352 Number of extensions: 6214 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 53 effective length of database: 439,323 effective search space used: 14058336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -