BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_K10 (543 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 25 1.2 AF164151-1|AAD47075.1| 148|Anopheles gambiae translation initia... 24 3.7 AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 23 6.5 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 25.4 bits (53), Expect = 1.2 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 310 TQVISCYSISVLIEGHHHVSKTF 242 T ++ ++ISV +EG VSKTF Sbjct: 192 TPMLGVWNISVEVEGEELVSKTF 214 >AF164151-1|AAD47075.1| 148|Anopheles gambiae translation initiation factor 4C (1A) protein. Length = 148 Score = 23.8 bits (49), Expect = 3.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 456 AMKLAGEKRICSYRGRFRI*YWYGE 530 AM G KR+C RG+ R W + Sbjct: 49 AMCFDGVKRLCHIRGKLRKKVWINQ 73 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 23.0 bits (47), Expect = 6.5 Identities = 10/30 (33%), Positives = 14/30 (46%), Gaps = 2/30 (6%) Frame = -2 Query: 536 KNFSIPISDPKPASVATYPFLA--SKFHRD 453 K F +P+ P P V Y + K HR+ Sbjct: 246 KKFEVPVPKPYPVPVTVYKHIMQNEKTHRN 275 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 561,015 Number of Sequences: 2352 Number of extensions: 11445 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50040333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -