BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_K10 (543 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 23 1.5 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 23 2.7 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 8.1 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 21 8.1 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 23.4 bits (48), Expect = 1.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 301 ISCYSISVLIEGHHHVSKTFLYIIHIIA 218 +S Y+I+ +IEG +H + H IA Sbjct: 87 LSTYNIAGIIEGQYHDDEDLKTFFHKIA 114 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 263 PPC*QDVPLYHPHHCL 216 PP +D+P+Y HH L Sbjct: 61 PPEHRDLPIYQSHHHL 76 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.0 bits (42), Expect = 8.1 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -2 Query: 428 AVCDVKRMDQCEREPECPLRFASKSAQTRRATTPEELL*YPSHQ 297 A D+K+ ++ + C S+++ +RA+ E L YP Q Sbjct: 607 ATKDIKQNEEITFDYMCQSSKNSENSIMQRASMKENLNVYPEFQ 650 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -3 Query: 472 PASFIAILSASIDEQPCAMLSEWT 401 P + SI E+P ML WT Sbjct: 7 PVLLVTANVGSIFEEPSVMLKIWT 30 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,256 Number of Sequences: 438 Number of extensions: 2880 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15459066 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -