BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_K03 (568 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest ... 33 0.10 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 30 0.94 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 30 0.94 At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.2 At4g28690.1 68417.m04099 expressed protein 29 1.6 At3g49050.1 68416.m05358 lipase class 3 family protein / calmodu... 29 1.6 At5g18560.1 68418.m02194 AP2 domain-containing transcription fac... 29 2.2 At5g60440.1 68418.m07581 MADS-box protein (AGL62) contains Pfal ... 29 2.9 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 28 5.0 At2g02490.1 68415.m00188 hydroxyproline-rich glycoprotein family... 28 5.0 At1g09280.2 68414.m01038 expressed protein contains Pfam profile... 28 5.0 At1g09280.1 68414.m01037 expressed protein contains Pfam profile... 28 5.0 At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family... 27 6.6 At4g11510.1 68417.m01849 expressed protein ; expression support... 27 6.6 At5g59460.1 68418.m07452 scarecrow-like transcription factor 11 ... 27 8.7 At1g15940.1 68414.m01913 expressed protein similar To androgen-i... 27 8.7 >At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest subunit (RPB205) (RPII) (RPB1) nearly identical to P|P18616 DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6) {Arabidopsis thaliana} Length = 1840 Score = 33.5 bits (73), Expect = 0.10 Identities = 29/121 (23%), Positives = 43/121 (35%) Frame = +1 Query: 97 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 276 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1661 SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPGYSPTSPSYSPTSPSY 1720 Query: 277 NPGQVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYP 456 P S S + A P + P + S NY P T P++ P+Y Sbjct: 1721 GPTSPSYNPQSAKYSPSIAYSPSNARLSP--ASPYSPTSPNYSP--TSPSYSP-TSPSYS 1775 Query: 457 P 459 P Sbjct: 1776 P 1776 Score = 33.1 bits (72), Expect = 0.13 Identities = 30/122 (24%), Positives = 45/122 (36%), Gaps = 1/122 (0%) Frame = +1 Query: 97 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 276 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1577 SPTYSPSSPGYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1636 Query: 277 NPGQVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGP-SGNYEPISTGPAFVDFNHPNY 453 +P S S S +P + PS P S +Y P T P++ P+Y Sbjct: 1637 SPTSPAYSPTSPAYSP-TSPAYSPTSPSYSPTSPSYSPTSPSYSP--TSPSYSP-TSPSY 1692 Query: 454 PP 459 P Sbjct: 1693 SP 1694 Score = 31.1 bits (67), Expect = 0.54 Identities = 15/59 (25%), Positives = 26/59 (44%) Frame = +1 Query: 106 YNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYNP 282 Y+P + +P Y+P + +P Y+P +P Y P + +PDY+P Sbjct: 1740 YSPSNARLSPASP-YSPTSPNYSPTSPSYSPTSPSYSPSSPTYSPSSPYSSGASPDYSP 1797 Score = 30.7 bits (66), Expect = 0.71 Identities = 32/123 (26%), Positives = 44/123 (35%), Gaps = 2/123 (1%) Frame = +1 Query: 97 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 276 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1542 SPGYSPSSPGYSPTSPGYSPTSPGYSPTSPGYSPTSPTYSPSSPGYSPTSPAYSPTSPSY 1601 Query: 277 NPGQVHVVDNSGVPS-DGNSDHVVIANPDPFFSQPSNGP-SGNYEPISTGPAFVDFNHPN 450 +P S PS S +P + PS P S Y P T PA+ P Sbjct: 1602 SPTSPSYSPTS--PSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSP--TSPAYSP-TSPA 1656 Query: 451 YPP 459 Y P Sbjct: 1657 YSP 1659 Score = 30.7 bits (66), Expect = 0.71 Identities = 31/127 (24%), Positives = 46/127 (36%), Gaps = 6/127 (4%) Frame = +1 Query: 97 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 276 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1647 SPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPGY 1706 Query: 277 NPGQVHVVDNS---GVPSDGNSDHVVIANPDPFFSQPSN---GPSGNYEPISTGPAFVDF 438 +P S G S + +P +S PSN P+ Y P T P + Sbjct: 1707 SPTSPSYSPTSPSYGPTSPSYNPQSAKYSPSIAYS-PSNARLSPASPYSP--TSPNYSP- 1762 Query: 439 NHPNYPP 459 P+Y P Sbjct: 1763 TSPSYSP 1769 Score = 29.9 bits (64), Expect = 1.2 Identities = 30/123 (24%), Positives = 46/123 (37%), Gaps = 2/123 (1%) Frame = +1 Query: 97 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 276 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1563 SPGYSPTSPGYSPTSPTYSPSSPGYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSY 1622 Query: 277 NPGQVHVVDNSGVPS-DGNSDHVVIANPDPFFSQPSNGP-SGNYEPISTGPAFVDFNHPN 450 +P S PS S +P + P+ P S +Y P T P++ P+ Sbjct: 1623 SPTSPSYSPTS--PSYSPTSPAYSPTSPAYSPTSPAYSPTSPSYSP--TSPSYSP-TSPS 1677 Query: 451 YPP 459 Y P Sbjct: 1678 YSP 1680 Score = 29.9 bits (64), Expect = 1.2 Identities = 26/106 (24%), Positives = 40/106 (37%), Gaps = 2/106 (1%) Frame = +1 Query: 97 NPDYNPGQVHVVNYNPD--YNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNP 270 +P YNP Y+P Y+P + +P Y+P + +P Y P +P Sbjct: 1724 SPSYNPQSA---KYSPSIAYSPSNARLSPASP-YSPTSPNYSPTSPSYSPT-------SP 1772 Query: 271 DYNPGQVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEP 408 Y+P +S S + D+ A P S +G Y P Sbjct: 1773 SYSPSSPTYSPSSPYSSGASPDYSPSAGYSPTLPGYSPSSTGQYTP 1818 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/62 (24%), Positives = 24/62 (38%) Frame = +1 Query: 97 NPDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDY 276 +P Y+P +P Y+P +P Y+P +P Y P +P Y Sbjct: 1640 SPAYSPTSPAYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAY 1699 Query: 277 NP 282 +P Sbjct: 1700 SP 1701 Score = 27.1 bits (57), Expect = 8.7 Identities = 30/120 (25%), Positives = 43/120 (35%), Gaps = 2/120 (1%) Frame = +1 Query: 106 YNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYNPG 285 Y G + +P Y+P +P Y+P +P Y P +P Y+P Sbjct: 1531 YVGGMAFSPSSSPGYSPSSPGYSPTSPGYSPTSPGYSPTSPGYSPTSPTYSPSSPGYSPT 1590 Query: 286 QVHVVDNSGVPS-DGNSDHVVIANPDPFFSQPSNGP-SGNYEPISTGPAFVDFNHPNYPP 459 S PS S +P + PS P S +Y P T P++ P Y P Sbjct: 1591 SPAYSPTS--PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP--TSPSYSP-TSPAYSP 1645 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 30.3 bits (65), Expect = 0.94 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +1 Query: 343 VIANPDPFFSQPSNGPSGNYEPISTGPAFVDFNHPNYPPKRYDXPLARGG 492 ++A P P+ P+ GP P+S+ PA N+P Y P GG Sbjct: 245 MMAPPPPYGQPPNAGPFTGNSPLSSPPAHSIPPPTNFPGVPYGRPPMPGG 294 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 30.3 bits (65), Expect = 0.94 Identities = 23/86 (26%), Positives = 38/86 (44%) Frame = +1 Query: 154 PGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYNPGQVHVVDNSGVPSDGNS 333 P + +NP+Y G VH N Y V++ +P P H +N + + G+S Sbjct: 879 PSRYPPASNNPNYTSGMVH---GNMQYQSQSVNMPQLSP--LPNMPH--NNYSMYTQGSS 931 Query: 334 DHVVIANPDPFFSQPSNGPSGNYEPI 411 +H V + ++ P+ NY PI Sbjct: 932 NHPVSQPMVQQYQPEASMPNQNYGPI 957 >At2g23260.1 68415.m02778 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 456 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 5 SDTIRQ*KLSCFSSSPYWPWLPQTECTWSIITLII-IQA 118 S I + + SC SSP+ PW+P + +I I+ IQA Sbjct: 96 SKIIEEKRYSCIISSPFTPWVPAVAASHNISCAILWIQA 134 >At4g28690.1 68417.m04099 expressed protein Length = 448 Score = 29.5 bits (63), Expect = 1.6 Identities = 22/70 (31%), Positives = 30/70 (42%), Gaps = 5/70 (7%) Frame = +1 Query: 226 PDYYPGQVHVVDHNPDYNPGQVHVVDN--SGVPSDGNSDHVVIANPDPFFSQPSNG---P 390 P + Q V NP P + + N SG + S VV +NP +PSNG P Sbjct: 225 PGHRTEQSRTVQQNPGSQPHAMQSLPNHKSGSNNGNPSPQVVPSNPYVLTRRPSNGVYPP 284 Query: 391 SGNYEPISTG 420 + + IS G Sbjct: 285 ENSVQNISQG 294 >At3g49050.1 68416.m05358 lipase class 3 family protein / calmodulin-binding heat-shock protein, putative calmodulin-binding heat-shock protein, Nicotiana tabacum, PIR:T04107 Length = 477 Score = 29.5 bits (63), Expect = 1.6 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +1 Query: 196 PGQVHVVDHNPDYYPGQV-HVVDHNPDYNPGQVHVVDNSGVPSDGNSDHVVIA 351 P Q + D Y PG++ H+V+ P G+ V + VP DG +H+V++ Sbjct: 272 PEQKMLKDPRRLYAPGRMYHIVERKP-CRLGRYPPVVKTAVPVDGRFEHIVLS 323 >At5g18560.1 68418.m02194 AP2 domain-containing transcription factor, putative AP2/EREBP-like transcription factor LEAFY PETIOLE, Arabidopsis thaliana, EMBL:AF216581 Length = 348 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 148 YNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQ--VHVVDHNPDY 276 Y P VH + NP+ + V ++N + P V+DH+P Y Sbjct: 112 YTPTDVHTILTNPNLHSLIVSPYNNNQSFLPNSSPQFVIDHHPHY 156 Score = 28.7 bits (61), Expect = 2.9 Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Frame = +1 Query: 106 YNPGQVHVVNYNPDYNPGQVHVVDHNPDY--NPGQVHVVDHNPDY 234 Y P VH + NP+ + V ++N + N V+DH+P Y Sbjct: 112 YTPTDVHTILTNPNLHSLIVSPYNNNQSFLPNSSPQFVIDHHPHY 156 >At5g60440.1 68418.m07581 MADS-box protein (AGL62) contains Pfal profile PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain) Length = 299 Score = 28.7 bits (61), Expect = 2.9 Identities = 18/61 (29%), Positives = 26/61 (42%) Frame = +1 Query: 100 PDYNPGQVHVVNYNPDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQVHVVDHNPDYN 279 P+YN VN+ P+YNP Q N N QV + N + + +H+ Y Sbjct: 244 PEYN------VNFRPEYNPNQ------NQIQNQNQVQIQIQNQSFKRENISEYEHHHGYP 291 Query: 280 P 282 P Sbjct: 292 P 292 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 27.9 bits (59), Expect = 5.0 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +1 Query: 355 PDPFFSQPSNGPSG--NYEPISTGPAFVDFNHPNYPPKRYDXPLAR 486 P P S P N P ++ P + P+ +N P PP YD P R Sbjct: 357 PYPQQSYPPNPPRQPPSHPPPGSAPSQQYYNAPPTPPSMYDGPGGR 402 >At2g02490.1 68415.m00188 hydroxyproline-rich glycoprotein family protein related to LENOD2 [Lupinus luteus] gi|296830|emb|CAA39050; and genefinder Length = 302 Score = 27.9 bits (59), Expect = 5.0 Identities = 33/134 (24%), Positives = 51/134 (38%), Gaps = 5/134 (3%) Frame = +1 Query: 82 HVVDHNPDYNPGQVHVVNYN--PDYNPGQVHVVDHNPDYNPGQVHVVDHNPDYYPGQV-- 249 H V +P + P Q ++ N P P H V +P + P Q + N YPG Sbjct: 52 HPVPPSPGHPPHQNAKISVNQYPSVFPIP-HPVPPSPGHPPHQNTKISVNQ--YPGVFPI 108 Query: 250 -HVVDHNPDYNPGQVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPA 426 H V +P + P Q + + P V P P P + P N ++ P Sbjct: 109 PHPVPPSPGHPPHQNAKISVNQYPG-------VFPIPHPVSPSPGHPPHQNEISVNQYPH 161 Query: 427 FVDFNHPNYPPKRY 468 + +HP P ++ Sbjct: 162 ILPISHPVPPSLKH 175 >At1g09280.2 68414.m01038 expressed protein contains Pfam profile: PF03959 domain of unknown function (DUF341) Length = 575 Score = 27.9 bits (59), Expect = 5.0 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -1 Query: 565 LENIIRLIIISPSFKIAYLYETFTSHHGREGXRIAWVDNWD 443 L+NI L+ I ++ ++Y+T T G + AW+ + D Sbjct: 374 LKNIAELVFIDAPHELQFIYQTATPPSGVCNKKFAWLVSSD 414 >At1g09280.1 68414.m01037 expressed protein contains Pfam profile: PF03959 domain of unknown function (DUF341) Length = 581 Score = 27.9 bits (59), Expect = 5.0 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -1 Query: 565 LENIIRLIIISPSFKIAYLYETFTSHHGREGXRIAWVDNWD 443 L+NI L+ I ++ ++Y+T T G + AW+ + D Sbjct: 380 LKNIAELVFIDAPHELQFIYQTATPPSGVCNKKFAWLVSSD 420 >At4g26750.1 68417.m03854 hydroxyproline-rich glycoprotein family protein Length = 421 Score = 27.5 bits (58), Expect = 6.6 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 376 PSNGPSGNYEPISTGPAFVDFNHP-NYPPKRYDXP 477 PS+ PS ++ P TGP+ + HP ++ P D P Sbjct: 236 PSSYPSNDHLPPPTGPSDSPYPHPYSHQPYHQDPP 270 >At4g11510.1 68417.m01849 expressed protein ; expression supported by MPSS Length = 85 Score = 27.5 bits (58), Expect = 6.6 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -1 Query: 316 EHHYCPPREPGLDYSQGCDQPR 251 +H CPP +P Y +GC++ + Sbjct: 49 DHGNCPPDQPANPYHRGCEKSK 70 >At5g59460.1 68418.m07452 scarecrow-like transcription factor 11 (SCL11) identical to cDNA scarecrow-like 11 (SCL11) mRNA, partial cds gi:4580526 Length = 172 Score = 27.1 bits (57), Expect = 8.7 Identities = 20/89 (22%), Positives = 34/89 (38%), Gaps = 2/89 (2%) Frame = +1 Query: 217 DHNPDYYPGQVHVVDHNPDYNPGQVHVVDNSGVPSDGNSD--HVVIANPDPFFSQPSNGP 390 D P G++ NP + N G PS +S+ + P+ +PS Sbjct: 54 DPQPGALLGRMSFQSFNPSIEKLHEEAI-NGGNPSSSSSNGGKKSFSEPESSKVEPSGET 112 Query: 391 SGNYEPISTGPAFVDFNHPNYPPKRYDXP 477 G+ + + + N PN P+ +D P Sbjct: 113 DGDLKRKQSEVVSEEQNRPNKSPRSFDKP 141 >At1g15940.1 68414.m01913 expressed protein similar To androgen-induced prostate proliferative shutoff associated protein (GI:4559410) [Homo sapiens] Length = 990 Score = 27.1 bits (57), Expect = 8.7 Identities = 17/68 (25%), Positives = 25/68 (36%) Frame = +1 Query: 259 DHNPDYNPGQVHVVDNSGVPSDGNSDHVVIANPDPFFSQPSNGPSGNYEPISTGPAFVDF 438 D PD + +N V + + + A +P +NG N EP + G Sbjct: 769 DAEPDRMEDHQELPENHNVETKTDGEEQEAAK-EPTAESKTNGEEPNAEPETDGKEHKSL 827 Query: 439 NHPNYPPK 462 PN PK Sbjct: 828 KEPNAEPK 835 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,901,426 Number of Sequences: 28952 Number of extensions: 300655 Number of successful extensions: 845 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 820 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1092379416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -