BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_K02 (571 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g62080.1 68418.m07791 protease inhibitor/seed storage/lipid t... 28 5.0 At2g20300.1 68415.m02371 protein kinase family protein contains ... 27 8.8 At1g07705.1 68414.m00830 NOT2/NOT3/NOT5 family protein contains ... 27 8.8 >At5g62080.1 68418.m07791 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to tapetum-specific protein a9 precursor {Brassica napus} SP|Q05772; contains Pfam protease inhibitor/seed storage/LTP family domain PF00234; supported by full-length cDNA Ceres:27795 Length = 95 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +3 Query: 300 GKPRGNSCISSTTPTRTCLETYAKA*RLLPSTCLLQP 410 G+P C + + R CL +A LPS C L P Sbjct: 52 GRPNSECCAALQSTNRDCLCNALRAATSLPSLCNLPP 88 >At2g20300.1 68415.m02371 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 744 Score = 27.1 bits (57), Expect = 8.8 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +3 Query: 408 PTLFSRRYPWKLLWSRSKAGRKNSKFYYSSYNPH--PRPILNTSPFSSR 548 P F+R +P L ++RSKA + + F++ NP P P SP SR Sbjct: 21 PICFARLFPMSLPFTRSKAHQMH--FFHPYLNPSVAPTPSPAFSPNPSR 67 >At1g07705.1 68414.m00830 NOT2/NOT3/NOT5 family protein contains Pfam PF04153: NOT2 / NOT3 / NOT5 family; similar to Rga (GI:1658504) [Drosophila melanogaster] Length = 444 Score = 27.1 bits (57), Expect = 8.8 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = -3 Query: 317 ISSRFPWSATRPTPRAWRGGLGSRVQVGLETS 222 I++ FP +RP+ +G LGSR++ GL S Sbjct: 135 INNDFPQLTSRPSSAGSQGQLGSRLKQGLGIS 166 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,163,916 Number of Sequences: 28952 Number of extensions: 257006 Number of successful extensions: 790 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 790 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1102220672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -