BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_K01 (597 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z98866-24|CAB11568.2| 366|Caenorhabditis elegans Hypothetical p... 30 1.4 AF047658-1|AAC04418.2| 348|Caenorhabditis elegans Hypothetical ... 29 2.5 Z69635-2|CAA93462.1| 555|Caenorhabditis elegans Hypothetical pr... 29 3.3 Z69635-1|CAA93459.1| 515|Caenorhabditis elegans Hypothetical pr... 29 3.3 AC006605-4|AAK85441.2| 1378|Caenorhabditis elegans Hypothetical ... 28 4.4 >Z98866-24|CAB11568.2| 366|Caenorhabditis elegans Hypothetical protein Y49E10.25 protein. Length = 366 Score = 29.9 bits (64), Expect = 1.4 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +3 Query: 258 KLLLEGQPNVVEYAYSLWYRSGEDIVXVYFPIEFRLLFNEDPV 386 KL+ GQP V +Y ++ W+ FP FR++ + DP+ Sbjct: 260 KLVTFGQPRVADYDHAAWH-------DATFPYSFRVINSRDPI 295 >AF047658-1|AAC04418.2| 348|Caenorhabditis elegans Hypothetical protein K03H6.2 protein. Length = 348 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 258 KLLLEGQPNVVEYAYSLWYRS 320 KLL GQP +YAYS W+++ Sbjct: 227 KLLTAGQPRTGDYAYSNWHQN 247 >Z69635-2|CAA93462.1| 555|Caenorhabditis elegans Hypothetical protein F19B6.1b protein. Length = 555 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 Query: 434 RRNYAGDRASFGAGQTKTGPRVSWKLYPIWYKNK 535 RR +G RA TKTG ++ K P WY K Sbjct: 64 RRTMSGGRAEHHLLTTKTGKKIYTKGRPPWYDKK 97 >Z69635-1|CAA93459.1| 515|Caenorhabditis elegans Hypothetical protein F19B6.1a protein. Length = 515 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +2 Query: 434 RRNYAGDRASFGAGQTKTGPRVSWKLYPIWYKNK 535 RR +G RA TKTG ++ K P WY K Sbjct: 24 RRTMSGGRAEHHLLTTKTGKKIYTKGRPPWYDKK 57 >AC006605-4|AAK85441.2| 1378|Caenorhabditis elegans Hypothetical protein C07H6.3 protein. Length = 1378 Score = 28.3 bits (60), Expect = 4.4 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = -3 Query: 457 SVASVIPSSNQAEEQVHHV*LVITTGSSLNNSRNSIGK*TXTMSSPDLYQ 308 S SV SN + + + H+ L T SSLN R++I ++ P+L Q Sbjct: 814 SSGSVGSGSNGSVQSIEHI-LKACTSSSLNEKRDAIVNLNQVITDPNLCQ 862 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,114,438 Number of Sequences: 27780 Number of extensions: 226454 Number of successful extensions: 479 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 472 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 479 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -