BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_J24 (578 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04110.1 68417.m00581 Toll-Interleukin-Resistance (TIR) domai... 28 3.9 At1g25300.1 68414.m03140 octicosapeptide/Phox/Bem1p (PB1) domain... 28 3.9 At4g16144.1 68417.m02448 expressed protein 27 9.0 At3g48830.1 68416.m05333 polynucleotide adenylyltransferase fami... 27 9.0 At1g17460.1 68414.m02141 myb family transcription factor contain... 27 9.0 >At4g04110.1 68417.m00581 Toll-Interleukin-Resistance (TIR) domain-containing protein domain signature TIR exists, suggestive of a disease resistance protein. Length = 239 Score = 28.3 bits (60), Expect = 3.9 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 118 YRKANSNRMARKLPFHRGNQFSLSETIGKRTPICMKKKLQRIIND-LMKLSL 270 ++K NR ++ R ++ T+G + IC + I ND L+KL+L Sbjct: 155 FKKTCQNRTEDEINLRRRALIDVANTLGYHSTICKANMTKEITNDVLVKLNL 206 >At1g25300.1 68414.m03140 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein similar to unknown protein GI:4262226 from [Arabidopsis thaliana] contains Pfam profile PF00564: PB1 domain Length = 272 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +2 Query: 419 LKPYPQEK-LHFVGVEINDVVVEKLVTFFDY 508 + P P EK LH++G E V+V + ++F D+ Sbjct: 21 IMPLPPEKSLHYIGGETRLVIVPRGISFLDF 51 >At4g16144.1 68417.m02448 expressed protein Length = 390 Score = 27.1 bits (57), Expect = 9.0 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +1 Query: 133 SNRMARKLPFHRGNQFSL-SETIGKRTPICMKKKLQRIINDLMKL 264 S+ ++ +PFHR Q SL E +G R K+L+ +IN+L L Sbjct: 54 SSLISETIPFHRDYQASLPQERLGSR------KRLRAVINELESL 92 >At3g48830.1 68416.m05333 polynucleotide adenylyltransferase family protein / RNA recognition motif (RRM)-containing protein similar to SP|P13685 Poly(A) polymerase (EC 2.7.7.19) {Escherichia coli O157:H7}; contains Pfam profiles PF01743: polyA polymerase family protein, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 881 Score = 27.1 bits (57), Expect = 9.0 Identities = 18/47 (38%), Positives = 25/47 (53%) Frame = +1 Query: 178 FSLSETIGKRTPICMKKKLQRIINDLMKLSLAMCSVQHLNHSTSTPS 318 FS E IGK+ PIC I ND++++S S Q+ +T T S Sbjct: 128 FSRCEIIGKKFPICH----VHIGNDMIEVSSFSTSAQNSLRNTRTGS 170 >At1g17460.1 68414.m02141 myb family transcription factor contains Pfam PF00249: Myb-like DNA-binding domain Length = 604 Score = 27.1 bits (57), Expect = 9.0 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +1 Query: 79 GSWTFLKRLSYSPY 120 G WT +K+LS+SPY Sbjct: 517 GKWTEIKKLSFSPY 530 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,376,482 Number of Sequences: 28952 Number of extensions: 254783 Number of successful extensions: 701 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -