BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_J23 (606 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc... 30 0.30 SPCC1827.01c |||DUF1253 family protein|Schizosaccharomyces pombe... 26 3.7 SPAC3A12.03c |mug145||ubiquitin-protein ligase E3 |Schizosacchar... 26 3.7 SPCC11E10.08 |rik1||silencing protein Rik1|Schizosaccharomyces p... 26 4.9 SPAC13F5.06c |sec10||exocyst complex subunit Sec10|Schizosacchar... 25 6.5 SPBC30D10.11 |gpi1||pig-Q|Schizosaccharomyces pombe|chr 2|||Manual 25 8.6 SPAC4D7.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 8.6 >SPAC3F10.11c |abc2||glutathione S-conjugate-exporting ATPase Abc2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1463 Score = 29.9 bits (64), Expect = 0.30 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 12 FFFFYCKQTFISIINKKNVYDCFKINDSVSKVL 110 F+ + K I ++ ++YDC+K N+SV VL Sbjct: 46 FWTIWLKSLVIMVLLFTHIYDCYKTNESVWNVL 78 >SPCC1827.01c |||DUF1253 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 652 Score = 26.2 bits (55), Expect = 3.7 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = +1 Query: 208 RSGMR*IWYSNCTSESAGCGSFFIYFDKCLLEGFRHYYTVT 330 R MR I N S++A C + FD LEG Y V+ Sbjct: 599 RMPMRTISEGNLDSDAAKCRIMYTKFDSICLEGIVGYQRVS 639 >SPAC3A12.03c |mug145||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 309 Score = 26.2 bits (55), Expect = 3.7 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +2 Query: 5 SFFFFFLLQTNVYFHH 52 +FFFF+L + VYF+H Sbjct: 38 NFFFFYLCRCCVYFYH 53 >SPCC11E10.08 |rik1||silencing protein Rik1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1040 Score = 25.8 bits (54), Expect = 4.9 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +2 Query: 392 GLRSNLLFISNFGISNF-TFLLVGLSLNTSSRRPFSPCFVQHRRYTRPVWSEVGTTYENQ 568 G+ NLL +S+ G F +++L +L S + F V RR+T + + + + Sbjct: 560 GVDRNLLLVSS-GSGEFKSYVLFKNNLVFSETKHFGTTPVSFRRFTMNIGTYIICNNDCP 618 Query: 569 NSLYGKFDKLCF 604 + +YG LC+ Sbjct: 619 HMVYGFNGALCY 630 >SPAC13F5.06c |sec10||exocyst complex subunit Sec10|Schizosaccharomyces pombe|chr 1|||Manual Length = 811 Score = 25.4 bits (53), Expect = 6.5 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 589 EFAVQGILVFVSCSYFRPNWTGISS 515 EF L F + Y +PNW G++S Sbjct: 206 EFLETNFLKFFNNEYRKPNWKGMAS 230 >SPBC30D10.11 |gpi1||pig-Q|Schizosaccharomyces pombe|chr 2|||Manual Length = 653 Score = 25.0 bits (52), Expect = 8.6 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +1 Query: 232 YSNCTSESAGCGSFFIYFDKCLLEGFRHYYTVT 330 Y NC S+ GS F ++ K HY + T Sbjct: 571 YLNCNSKPMSLGSMFEHYRKLARRLISHYLSKT 603 >SPAC4D7.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 600 Score = 25.0 bits (52), Expect = 8.6 Identities = 10/18 (55%), Positives = 13/18 (72%), Gaps = 2/18 (11%) Frame = +3 Query: 6 VFFFFFYCKQT--FISII 53 +FFF +YCKQ FIS + Sbjct: 73 IFFFVYYCKQALEFISTV 90 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,657,299 Number of Sequences: 5004 Number of extensions: 57811 Number of successful extensions: 182 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 182 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 266270664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -