BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_J21 (621 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 25 1.9 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 25 2.6 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 25.0 bits (52), Expect = 1.9 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 190 IKKRKEIFKRAEPICSKDYRIKERDEIRL-ARQAR 291 ++ R E +R E CS++ +KE+ L A+Q R Sbjct: 347 VRPRYEAMRRKEEECSRELNLKEQKRKELYAKQGR 381 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 24.6 bits (51), Expect = 2.6 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +2 Query: 389 CSCSGCVRSTTACSFVSTRPQ*TCFVSLSPILHGAT 496 C C G TRP +CFVS+ +L T Sbjct: 74 CYCEGHCPGNLQNGTCETRPGGSCFVSVEAVLDEET 109 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 628,956 Number of Sequences: 2352 Number of extensions: 12187 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60214320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -