BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_J21 (621 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 4.2 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 5.5 AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 22 5.5 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 22.2 bits (45), Expect = 4.2 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 208 IFKRAEPICSKDYRIKERDEIRL 276 I + + + S YR+KER EI + Sbjct: 562 ISQSTKELLSPSYRVKERGEIEV 584 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +2 Query: 350 VVSTKYHPRYARYCSCSGCVRSTTACSFVSTR 445 V+S KY + C CS S T S R Sbjct: 318 VMSAKYRNAFKETCRCSPSNPSITRTGLSSVR 349 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 160 QITLKRRSASIKKRKEIFKRAEPICSKDYRIKE 258 Q T++R +S + K I K + IC++ Y+I++ Sbjct: 101 QTTIEREFSSTEM-KAIMKVDDIICTRVYKIQD 132 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,290 Number of Sequences: 438 Number of extensions: 4009 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -