BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_J19 (430 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5C562 Cluster: SJCHGC04352 protein; n=1; Schistosoma j... 33 3.3 UniRef50_Q9AIM5 Cluster: Ribosomal protein S3; n=1; Candidatus C... 31 7.7 >UniRef50_Q5C562 Cluster: SJCHGC04352 protein; n=1; Schistosoma japonicum|Rep: SJCHGC04352 protein - Schistosoma japonicum (Blood fluke) Length = 213 Score = 32.7 bits (71), Expect = 3.3 Identities = 20/58 (34%), Positives = 26/58 (44%) Frame = +3 Query: 72 RHNFYEFEKLKTCPFYNFSN*VLLLNAATSNLSKNHQSQHLPGSRVSVPDFQGSGSLR 245 RHN + L F NF N + + N T+N + N Q L G S +GSLR Sbjct: 26 RHNSFPNNSLSR--FQNFDNYLTVSNVKTTNNNTNQSQQFLLGRSTSYSSSMWNGSLR 81 >UniRef50_Q9AIM5 Cluster: Ribosomal protein S3; n=1; Candidatus Carsonella ruddii|Rep: Ribosomal protein S3 - Carsonella ruddii Length = 148 Score = 31.5 bits (68), Expect = 7.7 Identities = 18/58 (31%), Positives = 32/58 (55%) Frame = -2 Query: 192 DAVIDDSLIN*MWLRSITTLSSKNYKKDMFSIFQTHKSYV*NIMLKSVYNFLIRNKKI 19 D +I + LI +++ ++ L+ D+F IFQ K NI+L V+N+++ K I Sbjct: 56 DIIISNKLIINLYINNVDLLNDIENYLDIF-IFQISKILKKNIILNFVFNYVLNAKNI 112 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 363,412,181 Number of Sequences: 1657284 Number of extensions: 6474452 Number of successful extensions: 17418 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16762 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17405 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 20653970351 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -