BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_J19 (430 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1150 + 31278367-31278885,31280065-31281278,31281759-31283355 29 1.2 05_05_0153 - 22766805-22767023,22767662-22767940,22768294-227684... 29 1.6 08_01_0327 - 2942640-2943456,2944386-2944515,2944679-2944811 29 2.1 04_04_1371 + 32995337-32995358,32995745-32995822,32995876-329960... 27 4.9 07_03_0539 - 19237573-19239169,19239258-19239410,19239505-192395... 27 8.5 05_04_0089 - 17821196-17821306,17821611-17821688,17821801-178218... 27 8.5 >04_04_1150 + 31278367-31278885,31280065-31281278,31281759-31283355 Length = 1109 Score = 29.5 bits (63), Expect = 1.2 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 341 PEETKRMMDHLSDAEHYRNEHHNKQFDH 424 P + + DH S H+R+ HH +Q H Sbjct: 123 PRDHRDQHDHQSQRHHHRHHHHQRQRHH 150 >05_05_0153 - 22766805-22767023,22767662-22767940,22768294-22768401, 22768500-22768779,22768871-22769174,22769367-22769975, 22770186-22770411 Length = 674 Score = 29.1 bits (62), Expect = 1.6 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +3 Query: 12 VFKFFYYELKNYILILTLYFRHNFYEFEK 98 ++ FFYY+ ++ I+T R N YEF+K Sbjct: 466 LYDFFYYQ--EHLFIVTELLRANLYEFQK 492 >08_01_0327 - 2942640-2943456,2944386-2944515,2944679-2944811 Length = 359 Score = 28.7 bits (61), Expect = 2.1 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 344 EETKRMMDHLSDAEHYRNEHHNKQFDHD 427 EE +R + H H+ +EH N Q+D + Sbjct: 295 EEEQRQLGHHHHQHHHEHEHENHQWDEE 322 >04_04_1371 + 32995337-32995358,32995745-32995822,32995876-32996019, 32997595-32997930,32998014-32998166,32998286-32998501, 32998600-33000695 Length = 1014 Score = 27.5 bits (58), Expect = 4.9 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +3 Query: 141 LLNAATSNLSKNHQSQHLPGSRVSVPDFQGSGS 239 L N NLS N S LPGS + +P SGS Sbjct: 249 LTNLKELNLSANGFSGSLPGSLLELPHLDPSGS 281 >07_03_0539 - 19237573-19239169,19239258-19239410,19239505-19239566, 19239855-19240103,19240248-19240337,19240453-19240632, 19240713-19240942,19241558-19241735,19242327-19242432, 19242786-19242883,19243683-19243813,19243908-19244087, 19244179-19244443,19244557-19244627,19244707-19244922, 19245147-19245294 Length = 1317 Score = 26.6 bits (56), Expect = 8.5 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 344 EETKRMMDHLSDAEHYRNEHHNKQFDHD 427 EE + MD+ +D Y E HN FD D Sbjct: 356 EEMMQEMDYNADRAWYDCEEHNTMFDGD 383 >05_04_0089 - 17821196-17821306,17821611-17821688,17821801-17821863, 17822167-17823021,17823121-17823236,17823930-17824004, 17826156-17826213 Length = 451 Score = 26.6 bits (56), Expect = 8.5 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -2 Query: 330 PANTAETAKATNRDLSI-LTSCKVPRQQNHVNFLIPENRERKRGSREDAVIDDSLIN 163 P +AE+A L++ L S + N V+ PE E S+E A++ D+L+N Sbjct: 306 PVISAESAHHWKETLNVSLESHFSSTETNVVSSECPETLENTSPSKEFAILRDTLVN 362 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,528,308 Number of Sequences: 37544 Number of extensions: 174786 Number of successful extensions: 385 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 385 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 802495716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -