BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_J19 (430 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37420.1 68418.m04502 hypothetical protein contains Pfam PF04... 28 3.1 At4g30935.1 68417.m04392 WRKY family transcription factor contai... 27 7.1 >At5g37420.1 68418.m04502 hypothetical protein contains Pfam PF04510 : Family of unknown function (DUF577)); common family comprised of At5g37410, At5g37400, At5g37920, At5g37460, At5g37650, At5g37470, At5g37420, At5g37430 Length = 579 Score = 27.9 bits (59), Expect = 3.1 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 413 AYCGAHSCSVQHQINDPSFVSSLQDLVLRRI 321 A+ GA C+V H I+DP + SL+++ + I Sbjct: 425 AFTGAF-CAVIHLIDDPDYAESLKEIAYKMI 454 >At4g30935.1 68417.m04392 WRKY family transcription factor contains Pfam profile: PF03106 WRKY DNA -binding domain Length = 466 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 368 DPSFVSSLQDLVLRRIPPKQQKR 300 DP+ S+ QDL L +P KQ++R Sbjct: 126 DPATASTAQDLPLVSVPTKQEQR 148 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,962,210 Number of Sequences: 28952 Number of extensions: 144185 Number of successful extensions: 389 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 389 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 675111616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -