BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_J15 (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60140.1 68416.m06715 glycosyl hydrolase family 1 protein con... 33 0.095 At4g22970.1 68417.m03315 peptidase C50 family protein contains P... 31 0.67 At2g40460.1 68415.m04993 proton-dependent oligopeptide transport... 29 2.0 At3g07050.1 68416.m00837 GTP-binding family protein contains Pfa... 29 2.7 At3g10430.1 68416.m01251 F-box family protein contains F-box dom... 28 3.6 At1g25540.1 68414.m03171 phytochrome and flowering time regulato... 28 3.6 At2g27570.1 68415.m03340 sulfotransferase family protein similar... 27 6.2 At5g60970.1 68418.m07648 TCP family transcription factor, putati... 27 8.3 At5g23910.1 68418.m02808 kinesin motor protein-related 27 8.3 At5g14950.1 68418.m01754 glycosyl hydrolase family 38 protein si... 27 8.3 At2g44460.1 68415.m05528 glycosyl hydrolase family 1 protein con... 27 8.3 >At3g60140.1 68416.m06715 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to Cyanogenic Beta-Glucosidase (GI:1311386)(pdb:1CBG) [Trifolium Repens]; identical beta-glucosidase GI:10834547 Length = 577 Score = 33.5 bits (73), Expect = 0.095 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +1 Query: 136 IRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQY 261 + Y ++ NN ++I +NG N + DG +P +++ +RI+Y Sbjct: 394 LNYIKERYNNMPVYIKENGINDNDDGTKPREEIVKDTFRIEY 435 >At4g22970.1 68417.m03315 peptidase C50 family protein contains Pfam PF03568: Peptidase family C50 Length = 1773 Score = 30.7 bits (66), Expect = 0.67 Identities = 23/76 (30%), Positives = 35/76 (46%) Frame = +2 Query: 245 VTEFNTLWTTIIIL*PSFFLIKCSSQTKHRYQVKGKHQLLALVEHHDKQLRNARRIAFQH 424 V++F + +I + L CSS + + K Q L L E K+L+NA+ I + Sbjct: 911 VSQFGVKFAGFLIPFVNKLLDLCSSSLISQGNLYHKKQCLDLAE---KELQNAKEILIAN 967 Query: 425 QNTTPCVVAXIKLTKT 472 Q CV +KL T Sbjct: 968 QRDFSCVKCKLKLEVT 983 >At2g40460.1 68415.m04993 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 583 Score = 29.1 bits (62), Expect = 2.0 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +2 Query: 329 HRYQVKGKHQLLALVEHHDKQLRNARRIAFQHQNTTPCVVAXIKLTK 469 H Y+ GKHQ+ HH R + A + + PC V +++ K Sbjct: 277 HYYKSNGKHQV-----HHTPVFRFLDKAAIKTSSRVPCTVTKVEVAK 318 >At3g07050.1 68416.m00837 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 582 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/44 (31%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = +2 Query: 302 LIKCSSQTKH-RYQVKGKHQLLALV-EHHDKQLRNARRIAFQHQ 427 ++K S ++K R +K KH++L V EHH K+ ++A+++ + Sbjct: 1 MVKRSKKSKSKRVTLKQKHKVLKKVKEHHKKKAKDAKKLGLHRK 44 >At3g10430.1 68416.m01251 F-box family protein contains F-box domain Pfam:PF00646 Length = 370 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 440 TGLYSGVEMQFSAHFSIVCRDVPPVLGVDVCP*PG 336 T S + FS +FS+ D+P +D+ P PG Sbjct: 266 TNKLSDEVVSFSRYFSVTLPDIPLFRSIDILPLPG 300 >At1g25540.1 68414.m03171 phytochrome and flowering time regulatory protein (PFT1) PMID: 12815435 Length = 836 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +2 Query: 320 QTKHRYQVKGKHQLLALVEHHDKQLRNARRIAFQHQNT 433 Q +H+ Q + +HQL L +HH +Q + ++ QHQ T Sbjct: 721 QQQHQQQQQQQHQLSQL-QHHQQQQQQQQQQQQQHQLT 757 >At2g27570.1 68415.m03340 sulfotransferase family protein similar to steroid sulfotransferase from [Brassica napus] GI:3420008, GI:3420006; contains Pfam profile PF00685: Sulfotransferase domain Length = 273 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 230 IHSGRFPS*DLFHPFLSINKFALFS 156 +H + PS D HP LS N LFS Sbjct: 88 VHRSKHPSHDHHHPLLSNNPHVLFS 112 >At5g60970.1 68418.m07648 TCP family transcription factor, putative putative basic helix-loop-helix DNA binding protein TCP2, Arabidopsis thaliana, EMBL:AF072691 Length = 360 Score = 27.1 bits (57), Expect = 8.3 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +1 Query: 178 IDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDNNYN 282 +DK W K+ + + + ++ Q+PL N YN Sbjct: 192 LDKGKWIKNDENSNQDHQGFNTNHQQQFPLTNPYN 226 >At5g23910.1 68418.m02808 kinesin motor protein-related Length = 665 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 496 FGHKIVFPGFCKFYXRYHTRGCILVL 419 FG + +F GF KFY + T IL+L Sbjct: 398 FGRRGIFSGFFKFYGSHGTAYLILLL 423 >At5g14950.1 68418.m01754 glycosyl hydrolase family 38 protein similar to alpha-mannosidase II SP:P27046 from [Mus musculus] Length = 1173 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 136 IRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPL 267 +RYK ++N + D NG+ S+ + IP+Q Y YP+ Sbjct: 883 VRYKTDVDNKKVFYSDLNGFQMSRRETYDK-IPLQGNY---YPM 922 >At2g44460.1 68415.m05528 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to beta-glucosidase 1 (GI:12043529) [Arabidopsis thaliana] Length = 582 Score = 27.1 bits (57), Expect = 8.3 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +1 Query: 136 IRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDN 273 + Y + NN ++I +NG N DG + + + +RI Y D+ Sbjct: 396 LNYIKDKYNNPIVYIKENGINDYDDGTKSREEILNDTFRISYHEDH 441 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,792,780 Number of Sequences: 28952 Number of extensions: 272330 Number of successful extensions: 610 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 610 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -