BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_J10 (626 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g54290.1 68414.m06189 eukaryotic translation initiation facto... 131 4e-31 At4g27130.1 68417.m03899 eukaryotic translation initiation facto... 129 2e-30 At5g54760.1 68418.m06820 eukaryotic translation initiation facto... 128 2e-30 At5g54940.2 68418.m06843 eukaryotic translation initiation facto... 124 5e-29 At5g54940.1 68418.m06842 eukaryotic translation initiation facto... 124 5e-29 At5g11900.1 68418.m01392 eukaryotic translation initiation facto... 35 0.038 At1g05530.1 68414.m00567 UDP-glucoronosyl/UDP-glucosyl transfera... 35 0.051 At3g62240.1 68416.m06992 zinc finger (C2H2 type) family protein ... 32 0.27 At2g47090.1 68415.m05882 zinc finger (C2H2 type) family protein ... 32 0.36 At2g15345.1 68415.m01755 expressed protein 30 1.4 At5g44180.1 68418.m05406 homeobox transcription factor, putative... 28 4.4 At4g18750.1 68417.m02771 pentatricopeptide (PPR) repeat-containi... 28 5.8 At3g42060.1 68416.m04315 myosin heavy chain-related 28 5.8 At1g63470.1 68414.m07177 DNA-binding family protein contains a A... 28 5.8 At1g63430.1 68414.m07173 leucine-rich repeat transmembrane prote... 28 5.8 At4g25790.1 68417.m03711 allergen V5/Tpx-1-related family protei... 27 7.7 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 27 7.7 At1g24120.1 68414.m03043 DNAJ heat shock protein, putative simil... 27 7.7 >At1g54290.1 68414.m06189 eukaryotic translation initiation factor SUI1, putative similar to P|P32911 Protein translation factor SUI1 {Saccharomyces cerevisiae}; contains Pfam profile PF01253: Translation initiation factor SUI1 Length = 113 Score = 131 bits (316), Expect = 4e-31 Identities = 59/110 (53%), Positives = 77/110 (70%) Frame = +3 Query: 120 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRKTLTTVQGLSSEYDLKKIVRAC 299 + +Q FDPFADA VH+R+QQRNGRK+LTTVQGL EY KI++ Sbjct: 4 LEVQVPTAFDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYSKILKDL 63 Query: 300 KKEFACNGTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 449 KKEF CNGTVV+ E G+V+QLQGDQR+N+ +L ++GLVK + +K+HGF Sbjct: 64 KKEFCCNGTVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113 >At4g27130.1 68417.m03899 eukaryotic translation initiation factor SUI1, putative similar to SP|P32911 Protein translation factor SUI1 {Saccharomyces cerevisiae}; contains Pfam profile PF01253: Translation initiation factor SUI1 Length = 113 Score = 129 bits (311), Expect = 2e-30 Identities = 58/102 (56%), Positives = 74/102 (72%) Frame = +3 Query: 144 FDPFADAIKSSEDDVQDGLVHVRIQQRNGRKTLTTVQGLSSEYDLKKIVRACKKEFACNG 323 FDPFADA VH+R+QQRNGRK+LTTVQGL EY KI++ KKEF CNG Sbjct: 12 FDPFADANAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFCCNG 71 Query: 324 TVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 449 TVV+ E G+V+QLQGDQR+N+ +L ++GLVK + +K+HGF Sbjct: 72 TVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113 >At5g54760.1 68418.m06820 eukaryotic translation initiation factor SUI1, putative similar to SP|P32911 Protein translation factor SUI1 {Saccharomyces cerevisiae}; contains Pfam profile PF01253: Translation initiation factor SUI1 Length = 113 Score = 128 bits (310), Expect = 2e-30 Identities = 58/102 (56%), Positives = 74/102 (72%) Frame = +3 Query: 144 FDPFADAIKSSEDDVQDGLVHVRIQQRNGRKTLTTVQGLSSEYDLKKIVRACKKEFACNG 323 FDPFADA VH+R+QQRNGRK+LTTVQGL EY KI++ KKEF CNG Sbjct: 12 FDPFADANVEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFCCNG 71 Query: 324 TVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 449 TVV+ E G+V+QLQGDQR+N+ +L ++GLVK + +K+HGF Sbjct: 72 TVVQDSELGQVIQLQGDQRKNVSTFLVQAGLVKKDNIKIHGF 113 >At5g54940.2 68418.m06843 eukaryotic translation initiation factor SUI1, putative similar to SP|P32911 Protein translation factor SUI1 {Saccharomyces cerevisiae}; contains Pfam profile PF01253: Translation initiation factor SUI1 Length = 112 Score = 124 bits (299), Expect = 5e-29 Identities = 53/110 (48%), Positives = 81/110 (73%) Frame = +3 Query: 120 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRKTLTTVQGLSSEYDLKKIVRAC 299 + IQ + +DPFA+A S ++ +H+RIQQRNG+K+LTTVQGL EY ++I++ Sbjct: 4 LDIQIPSAYDPFAEAKDSDAPGAKEN-IHIRIQQRNGKKSLTTVQGLKKEYSYERILKDL 62 Query: 300 KKEFACNGTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 449 KK+F CNG VV+ E G+++QLQGDQR+ + Q+L ++G+ K +Q+K+HGF Sbjct: 63 KKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKKDQIKIHGF 112 >At5g54940.1 68418.m06842 eukaryotic translation initiation factor SUI1, putative similar to SP|P32911 Protein translation factor SUI1 {Saccharomyces cerevisiae}; contains Pfam profile PF01253: Translation initiation factor SUI1 Length = 112 Score = 124 bits (299), Expect = 5e-29 Identities = 53/110 (48%), Positives = 81/110 (73%) Frame = +3 Query: 120 MSIQNLNTFDPFADAIKSSEDDVQDGLVHVRIQQRNGRKTLTTVQGLSSEYDLKKIVRAC 299 + IQ + +DPFA+A S ++ +H+RIQQRNG+K+LTTVQGL EY ++I++ Sbjct: 4 LDIQIPSAYDPFAEAKDSDAPGAKEN-IHIRIQQRNGKKSLTTVQGLKKEYSYERILKDL 62 Query: 300 KKEFACNGTVVEHPEYGEVLQLQGDQRENICQWLTKSGLVKPEQLKVHGF 449 KK+F CNG VV+ E G+++QLQGDQR+ + Q+L ++G+ K +Q+K+HGF Sbjct: 63 KKDFCCNGNVVQDKELGKIIQLQGDQRKKVSQFLVQTGIAKKDQIKIHGF 112 >At5g11900.1 68418.m01392 eukaryotic translation initiation factor SUI1 family protein similar to SP|O43583 Density-regulated protein (DRP1 protein) (Smooth muscle cell associated protein-3) {Homo sapiens}; contains Pfam profile PF01253: Translation initiation factor SUI1 Length = 198 Score = 35.1 bits (77), Expect = 0.038 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Frame = +3 Query: 222 RNGRKTLTTVQGLSS-EYDLKKIVRACKKEFACNGTVVEHPEYGEVLQLQGDQRENICQW 398 RN RK +T V+GL L + K+FA +VV+ P E + +QGD +I ++ Sbjct: 114 RNKRKCITIVKGLELFGIKLSDASKKLGKKFATGASVVKGPTEKEQIDVQGDIIYDIVEF 173 Query: 399 LTKSGLVKPEQ 431 +T + PE+ Sbjct: 174 ITDTWPDVPER 184 >At1g05530.1 68414.m00567 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 455 Score = 34.7 bits (76), Expect = 0.051 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 3/57 (5%) Frame = +3 Query: 84 VSLKQRASTFNRMSIQNLN--TF-DPFADAIKSSEDDVQDGLVHVRIQQRNGRKTLT 245 +S+ R+ N +++NL+ TF D F D + S+ DDVQ+ LVH +RNG K L+ Sbjct: 41 LSVIHRSMIPNHNNVENLSFLTFSDGFDDGVISNTDDVQNRLVHF---ERNGDKALS 94 >At3g62240.1 68416.m06992 zinc finger (C2H2 type) family protein contains Pfam PF00096: Zinc finger, C2H2 type Length = 812 Score = 32.3 bits (70), Expect = 0.27 Identities = 19/54 (35%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = +1 Query: 250 CRACPRNM--T*RRSCGHARRSSRATVPLWSTRSTARCCNCKATSARTFVSGSL 405 C C N+ SCGH S V L RCC CK S FV+ +L Sbjct: 5 CAVCADNLEWVAYGSCGHREVCSTCVVRLRFVLDDPRCCICKTESPIVFVTKAL 58 >At2g47090.1 68415.m05882 zinc finger (C2H2 type) family protein contains Prosite PS00028: Zinc finger, C2H2 type, domain Length = 745 Score = 31.9 bits (69), Expect = 0.36 Identities = 27/103 (26%), Positives = 38/103 (36%), Gaps = 3/103 (2%) Frame = +1 Query: 250 CRACPRNM--T*RRSCGHARRSSRATVPLWSTRSTARCCNCKATSARTFVSGSLNRAL*S 423 C C N+ SCGH S V L + RCC CK FV+ +L + Sbjct: 5 CAVCAENLEWVGYGSCGHREVCSTCVVRLRFILNDRRCCICKTECPVVFVTKALGDYTKT 64 Query: 424 PSN*KFTAFRPPRTYHVQKILYYAR-RLRVINLNKYVSRRHRC 549 S+ T P+ V Y+ + +LN Y + C Sbjct: 65 ISDFSTTFPSVPKEGRVGSFWYHEETNVYFDDLNHYTRIKAMC 107 >At2g15345.1 68415.m01755 expressed protein Length = 121 Score = 29.9 bits (64), Expect = 1.4 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 5/52 (9%) Frame = +3 Query: 195 GLVHVRIQQ--RNGRKTLTTVQGL--SSEYD-LKKIVRACKKEFACNGTVVE 335 GLV++ QQ R G K L ++GL + Y LKK R+C KE+ + +E Sbjct: 3 GLVNMVYQQTERLGYKNLEMIKGLDRTENYSKLKKYYRSCVKEYELSNKAIE 54 >At5g44180.1 68418.m05406 homeobox transcription factor, putative similar to homeobox transcription factor Hox7/homeotic protein Hox7 (GI:19486) {Lycopersicon peruvianum}; similar to GP|4165087| Williams-Beuren syndrome deletion transcript 9 [Homo sapiens]; contains Pfam PF02791: DDT domain and Pfam PF00046: Homeobox domain Length = 1694 Score = 28.3 bits (60), Expect = 4.4 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 Query: 101 SIYVQSYVHPESEHIRPIRRCYQ 169 +IYV+S V P +H+RPIR YQ Sbjct: 191 NIYVRSDVKPIKDHVRPIRE-YQ 212 >At4g18750.1 68417.m02771 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 871 Score = 27.9 bits (59), Expect = 5.8 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = +2 Query: 449 LGRHAHTMFKKYCIMRGDYAL*TLINMYLEGTD------VYREESSRPV 577 LGR H++ K C R D TL++MY + D V+RE S R V Sbjct: 314 LGRAVHSIGVKACFSREDRFCNTLLDMYSKCGDLDSAKAVFREMSDRSV 362 >At3g42060.1 68416.m04315 myosin heavy chain-related Length = 712 Score = 27.9 bits (59), Expect = 5.8 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -3 Query: 453 PKSRELLVARASQGPI**ATDKCSRAGRLAVAAPRRTPGAPQRY 322 P+SR ++A+ PI + +C R R + PR PGA +R+ Sbjct: 663 PESRMKILAKGR--PIWQSKGRCDRGSRDSCKRPRPLPGAAERW 704 >At1g63470.1 68414.m07177 DNA-binding family protein contains a AT hook motif (DNA binding motifs with a preference for A/T rich regions), Pfam:PF02178 Length = 378 Score = 27.9 bits (59), Expect = 5.8 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Frame = -3 Query: 333 PQRYRCTRTPSCMP--ARSSSSHIPRTSPAPWSMFYARSAAGFGRALDHLARRP 178 P TP P A S+ H P+ PA + S +G GR+LD +R P Sbjct: 317 PTNSEMETTPGSAPEAAASTGQHTPQNFPAQGMSGWPVSGSGSGRSLDS-SRNP 369 >At1g63430.1 68414.m07173 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profiles: PF00069 Eukaryotic protein kinase domain, PF00560 Leucine Rich Repeat; contains 1 predicted transmembrane domain Length = 664 Score = 27.9 bits (59), Expect = 5.8 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +3 Query: 273 DLKKIVRACKKEFACNGTVVEHPEYGEVLQLQGDQRENI 389 ++ R E+A NGT+ EH YGE + +R I Sbjct: 429 EISPFTRMLVFEYASNGTLYEHLHYGEAALVSWARRMKI 467 >At4g25790.1 68417.m03711 allergen V5/Tpx-1-related family protein similar to SP|Q40374 Pathogenesis-related protein PR-1 precursor {Medicago truncatula}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 210 Score = 27.5 bits (58), Expect = 7.7 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +2 Query: 545 DVYREESSRPVRPLAPPCLANP 610 D YR RP+ P PP +A P Sbjct: 27 DYYRHRPQRPITPSPPPYVAKP 48 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -3 Query: 333 PQRYRCTRTPSCMPARSSSSHIPRTSPAP 247 P++ RT SC+PAR +S PR P Sbjct: 224 PEKRMYNRTVSCLPARPFNSGKPREQQQP 252 >At1g24120.1 68414.m03043 DNAJ heat shock protein, putative similar to Altered Response to Gravity [Arabidopsis thaliana] GI:4249662; contains Pfam profile PF00226 DnaJ domain Length = 436 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +1 Query: 52 SYIVEVRCIAAFH*NKEHLRSI 117 SY ++V C AAF KE LRS+ Sbjct: 279 SYTIQVLCAAAFTQEKEDLRSV 300 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,163,593 Number of Sequences: 28952 Number of extensions: 297956 Number of successful extensions: 862 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 833 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -