BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_J09 (416 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK131302-1|BAD18470.1| 626|Homo sapiens protein ( Homo sapiens ... 49 5e-06 AK128824-1|BAC87625.1| 706|Homo sapiens protein ( Homo sapiens ... 30 2.7 X75953-1|CAA53566.1| 355|Homo sapiens HLA-B alpha-chain protein. 29 8.2 AJ550735-1|CAD79566.1| 362|Homo sapiens MHC class I antigen pro... 29 8.2 AJ295279-1|CAC17137.1| 362|Homo sapiens MHC class I antigen pro... 29 8.2 >AK131302-1|BAD18470.1| 626|Homo sapiens protein ( Homo sapiens cDNA FLJ16275 fis, clone NT2RI2027157, moderately similar to Mouse SDR2 mRNA. ). Length = 626 Score = 49.2 bits (112), Expect = 5e-06 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 5/105 (4%) Frame = +1 Query: 1 GHSIDVVISGKTPEDKMAGILLEARQGDKI----VGTWTVSPDDTFSQPLNCGE-PNNAV 165 G I+V +SG G LLEAR + + +G++T+ D SQ L C + +AV Sbjct: 61 GDQIEVTLSGHP----FKGFLLEARNAEDLNGPPIGSFTLI-DSEVSQLLTCEDIQGSAV 115 Query: 166 THKMHAKELDRQTVSYPWTAPKDLEGDVVFKVTIVKSYAVFWVGI 300 +H+ +K+ + + W AP F VT+V+ Y ++WV I Sbjct: 116 SHRSASKKTE---IKVYWNAPSSAPNHTQFLVTVVEKYKIYWVKI 157 >AK128824-1|BAC87625.1| 706|Homo sapiens protein ( Homo sapiens cDNA FLJ46160 fis, clone TESTI4002141. ). Length = 706 Score = 30.3 bits (65), Expect = 2.7 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = -2 Query: 109 LRSKCRRSCHPDELPGGCRPFCLRVFC 29 LR+ C P + GGC C+RV C Sbjct: 241 LRASVSECCVPGDAQGGCAGICVRVLC 267 >X75953-1|CAA53566.1| 355|Homo sapiens HLA-B alpha-chain protein. Length = 355 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +3 Query: 237 RRRRCVQGHHCQELRRLLGRNRISPRKGSKSLNHVSHHHLLDVNINL 377 +RR ++G + LRR L + + ++ HV+HH + D + L Sbjct: 179 QRRAYLEGTCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTL 225 >AJ550735-1|CAD79566.1| 362|Homo sapiens MHC class I antigen protein. Length = 362 Score = 28.7 bits (61), Expect = 8.2 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +3 Query: 237 RRRRCVQGHHCQELRRLLGRNRISPRKGSKSLNHVSHHHLLDVNINL 377 +RR ++G + LRR L + + ++ HV+HH + D + L Sbjct: 179 QRRAYLEGTCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTL 225 >AJ295279-1|CAC17137.1| 362|Homo sapiens MHC class I antigen protein. Length = 362 Score = 28.7 bits (61), Expect = 8.2 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 243 RRCVQGHHCQELRRLLGRNRISPRKGSKSLNHVSHHHLLD 362 R C++G + LRR L + + ++ HV+HH + D Sbjct: 181 RACLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISD 220 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,954,066 Number of Sequences: 237096 Number of extensions: 1477767 Number of successful extensions: 4343 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4219 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4343 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3144905170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -