BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_J07 (545 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual 27 1.8 SPCC645.05c |myo2|rng5|myosin II heavy chain|Schizosaccharomyces... 25 5.5 SPAC19A8.11c |||recombination protein Irc6 |Schizosaccharomyces ... 25 7.3 SPAC227.09 |||folylpolyglutamate synthase|Schizosaccharomyces po... 25 7.3 SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyce... 25 7.3 SPAC11H11.02c |mug162||sequence orphan|Schizosaccharomyces pombe... 25 9.6 SPCC126.09 |||vacuolar membrane zinc transporter |Schizosaccharo... 25 9.6 >SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual Length = 4717 Score = 27.1 bits (57), Expect = 1.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -1 Query: 278 IAVQYNSIFYTVLDYFRDYHFCNLDSTYNMET 183 + Q+ ++ +VLDYF + H NLDS + T Sbjct: 3851 VCEQFINLAESVLDYFINVHNSNLDSLSKIST 3882 >SPCC645.05c |myo2|rng5|myosin II heavy chain|Schizosaccharomyces pombe|chr 3|||Manual Length = 1526 Score = 25.4 bits (53), Expect = 5.5 Identities = 7/26 (26%), Positives = 17/26 (65%) Frame = +3 Query: 276 DYTFNNDTSGLVVKWFFKSKSRLVYQ 353 +++ + + S ++W+ KSR+V+Q Sbjct: 236 EFSLSGEISNAAIEWYLLEKSRVVHQ 261 >SPAC19A8.11c |||recombination protein Irc6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 246 Score = 25.0 bits (52), Expect = 7.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +3 Query: 276 DYTFNNDTSGLVVKWFFKSK 335 D FNND SGL+ K+ ++K Sbjct: 31 DEAFNNDHSGLIHKYNIRNK 50 >SPAC227.09 |||folylpolyglutamate synthase|Schizosaccharomyces pombe|chr 1|||Manual Length = 417 Score = 25.0 bits (52), Expect = 7.3 Identities = 13/59 (22%), Positives = 30/59 (50%) Frame = +3 Query: 171 LLVTCFHVIRGVKITKMVVPEIIQYGVEDAVILDCDYTFNNDTSGLVVKWFFKSKSRLV 347 ++ T F + G+ K + PE+I+ + ++C YT +N T +++ + S ++ Sbjct: 341 VIATNFSSVSGMPWIKSMEPEVIKNSISSESSVEC-YTADNLTISEILRLAKEKNSSVI 398 >SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyces pombe|chr 2|||Manual Length = 568 Score = 25.0 bits (52), Expect = 7.3 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 124 EGGLTVCR*RIYAQSFCLSPVSMLYVESRL 213 EGG T+ + Y Q L+ S LY+E+ L Sbjct: 298 EGGATLFKFNYYGQDAYLTQSSQLYLEAAL 327 >SPAC11H11.02c |mug162||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 264 Score = 24.6 bits (51), Expect = 9.6 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +3 Query: 84 SIVLWYGDSYEMVRRRVDRVSLTHLCTILLLVTCFHVIRGVK 209 S +++YG E DRV L I C+ IR +K Sbjct: 88 SSLMFYGLMMEFFGYSFDRVGCMELAFISFSAACYFNIRSIK 129 >SPCC126.09 |||vacuolar membrane zinc transporter |Schizosaccharomyces pombe|chr 3|||Manual Length = 418 Score = 24.6 bits (51), Expect = 9.6 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = +1 Query: 133 LTVCR*RIYAQS---FCLSPVSMLYVESRLQKW 222 LT C+ RI + S FC+ S +Y++ + KW Sbjct: 30 LTTCQLRILSLSINAFCVFGASGIYLDKLVNKW 62 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,323,803 Number of Sequences: 5004 Number of extensions: 47720 Number of successful extensions: 139 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 139 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 225926624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -