BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_J07 (545 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 26 0.93 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 1.6 AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. 24 3.8 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 3.8 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 24 3.8 AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 pr... 23 8.7 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 23 8.7 AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. 23 8.7 AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. 23 8.7 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.8 bits (54), Expect = 0.93 Identities = 13/54 (24%), Positives = 28/54 (51%) Frame = -1 Query: 335 F*LEEPFHYEA*RVIVESIIAVQYNSIFYTVLDYFRDYHFCNLDSTYNMETGDK 174 F ++ F+YE+ + +S+ + Y+ V Y + +H + +TY +T D+ Sbjct: 1787 FPTQDGFYYESEQYPDQSVYVLVYDKRKLKVASYVKTHHGDHHLTTYMYDTNDR 1840 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 25.0 bits (52), Expect = 1.6 Identities = 13/54 (24%), Positives = 27/54 (50%) Frame = -1 Query: 335 F*LEEPFHYEA*RVIVESIIAVQYNSIFYTVLDYFRDYHFCNLDSTYNMETGDK 174 F ++ F+YE+ + S+ + Y+ V Y + +H + +TY +T D+ Sbjct: 1788 FPTQDGFYYESEQYPRRSVYVLVYDKRKLKVASYVKTHHGDHHLTTYMYDTNDR 1841 >AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. Length = 215 Score = 23.8 bits (49), Expect = 3.8 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +3 Query: 213 TKMVVPEIIQYGVEDAVILDCDYTFNNDT 299 +K P+I++Y +D + D D F++D+ Sbjct: 80 SKKTNPQIVEYEFDDDLPFDDDSDFDDDS 108 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.8 bits (49), Expect = 3.8 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -1 Query: 236 YFRDYHFCNLDSTYNMETGDKQKDCA*MRQRH 141 Y +D HF N D YN + G + + + RH Sbjct: 1697 YGQDSHFMNSDYEYNWKNGFGEDEQITILARH 1728 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 23.8 bits (49), Expect = 3.8 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -1 Query: 512 SGHYTSIITRDISVRFNNA 456 SG Y +++T D++ FN+A Sbjct: 539 SGRYCAVVTLDVTNAFNSA 557 >AY745226-1|AAU93493.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 22.6 bits (46), Expect = 8.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 463 IMRKALCIFRGSLDALYVRSTRPLSIPI 380 IMRK +G ++YVR P+ IP+ Sbjct: 12 IMRKGFRDEQGHDMSIYVREGTPILIPV 39 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 22.6 bits (46), Expect = 8.7 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +3 Query: 213 TKMVVPEIIQYGVEDAVILDCDYTFNND 296 +K P+I++Y +D D D F++D Sbjct: 310 SKKTNPQIVEYEFDDDFPFDDDSDFDDD 337 >AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 22.6 bits (46), Expect = 8.7 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +3 Query: 213 TKMVVPEIIQYGVEDAVILDCDYTFNND 296 +K P+I++Y +D D D F++D Sbjct: 80 SKKTNPQIVEYEFDDDFPFDDDSDFDDD 107 >AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 22.6 bits (46), Expect = 8.7 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +3 Query: 213 TKMVVPEIIQYGVEDAVILDCDYTFNND 296 +K P+I++Y +D D D F++D Sbjct: 80 SKKTNPQIVEYEFDDDFPFDDDSDFDDD 107 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 582,899 Number of Sequences: 2352 Number of extensions: 12319 Number of successful extensions: 23 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -