BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_J07 (545 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC044240-1|AAH44240.1| 502|Homo sapiens immunoglobulin-like dom... 30 6.1 AY672839-1|AAT77414.1| 457|Homo sapiens immunoglobulin-like dom... 30 6.1 AY672838-1|AAT77413.1| 514|Homo sapiens immunoglobulin-like dom... 30 6.1 AY672837-1|AAT77412.1| 546|Homo sapiens immunoglobulin-like dom... 30 6.1 AY134857-1|AAN10256.1| 265|Homo sapiens unknown protein. 30 6.1 AK129974-1|BAC85264.1| 211|Homo sapiens protein ( Homo sapiens ... 30 6.1 BC054035-1|AAH54035.1| 396|Homo sapiens chromosome 17 open read... 29 8.0 BC047325-1|AAH47325.1| 396|Homo sapiens chromosome 17 open read... 29 8.0 BC035715-1|AAH35715.1| 396|Homo sapiens chromosome 17 open read... 29 8.0 BC026017-1|AAH26017.1| 396|Homo sapiens chromosome 17 open read... 29 8.0 AB062437-1|BAB93500.1| 136|Homo sapiens OK/SW-CL.19 protein. 29 8.0 >BC044240-1|AAH44240.1| 502|Homo sapiens immunoglobulin-like domain containing receptor 1 protein. Length = 502 Score = 29.9 bits (64), Expect = 6.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 258 AVILDCDYTFNNDTSGLVVKWFFKS 332 ++IL CDYT + +VV W FKS Sbjct: 40 SIILKCDYTTSAQLQDVVVTWRFKS 64 >AY672839-1|AAT77414.1| 457|Homo sapiens immunoglobulin-like domain-containing receptor 1 beta protein. Length = 457 Score = 29.9 bits (64), Expect = 6.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 258 AVILDCDYTFNNDTSGLVVKWFFKS 332 ++IL CDYT + +VV W FKS Sbjct: 40 SIILKCDYTTSAQLQDVVVTWRFKS 64 >AY672838-1|AAT77413.1| 514|Homo sapiens immunoglobulin-like domain-containing receptor 1 alpha' protein. Length = 514 Score = 29.9 bits (64), Expect = 6.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 258 AVILDCDYTFNNDTSGLVVKWFFKS 332 ++IL CDYT + +VV W FKS Sbjct: 52 SIILKCDYTTSAQLQDVVVTWRFKS 76 >AY672837-1|AAT77412.1| 546|Homo sapiens immunoglobulin-like domain-containing receptor 1 alpha protein. Length = 546 Score = 29.9 bits (64), Expect = 6.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 258 AVILDCDYTFNNDTSGLVVKWFFKS 332 ++IL CDYT + +VV W FKS Sbjct: 40 SIILKCDYTTSAQLQDVVVTWRFKS 64 >AY134857-1|AAN10256.1| 265|Homo sapiens unknown protein. Length = 265 Score = 29.9 bits (64), Expect = 6.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 258 AVILDCDYTFNNDTSGLVVKWFFKS 332 ++IL CDYT + +VV W FKS Sbjct: 40 SIILKCDYTTSAQLQDVVVTWRFKS 64 >AK129974-1|BAC85264.1| 211|Homo sapiens protein ( Homo sapiens cDNA FLJ26464 fis, clone KDN04209. ). Length = 211 Score = 29.9 bits (64), Expect = 6.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 258 AVILDCDYTFNNDTSGLVVKWFFKS 332 ++IL CDYT + +VV W FKS Sbjct: 40 SIILKCDYTTSAQLQDVVVTWRFKS 64 >BC054035-1|AAH54035.1| 396|Homo sapiens chromosome 17 open reading frame 75 protein. Length = 396 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +2 Query: 143 VVDASMHNPSACHLFP---CYTWSQDYKNGSPGNNPIRCRR 256 V+D S P C+ C W Q + NG+ G NP R+ Sbjct: 277 VIDCSSSQPQFCNAGSNRFCEDWMQAFLNGAKGGNPFLFRQ 317 >BC047325-1|AAH47325.1| 396|Homo sapiens chromosome 17 open reading frame 75 protein. Length = 396 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +2 Query: 143 VVDASMHNPSACHLFP---CYTWSQDYKNGSPGNNPIRCRR 256 V+D S P C+ C W Q + NG+ G NP R+ Sbjct: 277 VIDCSSSQPQFCNAGSNRFCEDWMQAFLNGAKGGNPFLFRQ 317 >BC035715-1|AAH35715.1| 396|Homo sapiens chromosome 17 open reading frame 75 protein. Length = 396 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +2 Query: 143 VVDASMHNPSACHLFP---CYTWSQDYKNGSPGNNPIRCRR 256 V+D S P C+ C W Q + NG+ G NP R+ Sbjct: 277 VIDCSSSQPQFCNAGSNRFCEDWMQAFLNGAKGGNPFLFRQ 317 >BC026017-1|AAH26017.1| 396|Homo sapiens chromosome 17 open reading frame 75 protein. Length = 396 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +2 Query: 143 VVDASMHNPSACHLFP---CYTWSQDYKNGSPGNNPIRCRR 256 V+D S P C+ C W Q + NG+ G NP R+ Sbjct: 277 VIDCSSSQPQFCNAGSNRFCEDWMQAFLNGAKGGNPFLFRQ 317 >AB062437-1|BAB93500.1| 136|Homo sapiens OK/SW-CL.19 protein. Length = 136 Score = 29.5 bits (63), Expect = 8.0 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +2 Query: 143 VVDASMHNPSACHLFP---CYTWSQDYKNGSPGNNPIRCRR 256 V+D S P C+ C W Q + NG+ G NP R+ Sbjct: 17 VIDCSSSQPQFCNAGSNRFCEDWMQAFLNGAKGGNPFLFRQ 57 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,490,796 Number of Sequences: 237096 Number of extensions: 1613938 Number of successful extensions: 3468 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3467 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5364536570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -