BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_J07 (545 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 30 0.018 DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 25 0.50 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 3.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 4.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 4.7 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 21 6.2 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 6.2 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 6.2 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 21 6.2 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 8.2 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 8.2 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 29.9 bits (64), Expect = 0.018 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -2 Query: 151 VNDTRSTRLRTISYESPYHRTIDRKHCSLSRNDVTES*EITPRTWRPL 8 ++D+ S RL T YH ++ KHC++ R V E+ + T RP+ Sbjct: 1662 ISDSESGRLDTEMSTWGYHHNVN-KHCTIHRTQVKETDDKICFTMRPV 1708 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 25.0 bits (52), Expect = 0.50 Identities = 13/49 (26%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = -1 Query: 272 VQYNSIFYTVLDYFRDYHFCNLDSTYNMETGDK-QKDCA*MRQRHTVNP 129 ++YN + + + F++ +DS N+++ DK +K M+ + VNP Sbjct: 89 IRYNLLKKVIPEAFKEIGVEMIDSCSNVDSSDKCEKSFMFMKCMYEVNP 137 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 3.5 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +3 Query: 423 SSDPLKM--HRALRIIKTNTDISGDYTCVVSTFMDEDSKTKQM 545 SSD L+ +L I + + +G+Y+C V D+ T Q+ Sbjct: 1319 SSDRLRQLPEGSLFIKEVDRTDAGEYSCYVENTFGHDTVTHQL 1361 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 453 LRIIKTNTDISGDYTCVVS 509 L I + SGDYTCV + Sbjct: 674 LSITNLAAEHSGDYTCVAA 692 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 4.7 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 453 LRIIKTNTDISGDYTCVVSTFMDEDSKTKQM 545 L I + D +G+Y+CV E S T+++ Sbjct: 670 LMIEHLSPDHNGNYSCVARNLAAEVSHTQRL 700 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 21.4 bits (43), Expect = 6.2 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = -2 Query: 343 NLDFDLKNHFTTRP 302 +L++ L+NHF ++P Sbjct: 3 HLEYHLRNHFGSKP 16 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 260 SIFYTVLDYFRDY 222 SI+ T+LDY+ Y Sbjct: 419 SIYKTILDYYHKY 431 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 260 SIFYTVLDYFRDY 222 SI+ T+LDY+ Y Sbjct: 419 SIYKTILDYYHKY 431 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 260 SIFYTVLDYFRDY 222 SI+ T+LDY+ Y Sbjct: 45 SIYKTILDYYHKY 57 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.0 bits (42), Expect = 8.2 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 385 PIS*GFCPTIH*YTNLDFDLKNHFTTRP 302 PI+ GF TI + F +N F++ P Sbjct: 292 PINSGFYSTIMYSNGVTFPQRNRFSSLP 319 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.0 bits (42), Expect = 8.2 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 385 PIS*GFCPTIH*YTNLDFDLKNHFTTRP 302 PI+ GF TI + F +N F++ P Sbjct: 292 PINSGFYSTIMYSNGVTFPQRNRFSSLP 319 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,314 Number of Sequences: 438 Number of extensions: 3462 Number of successful extensions: 13 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -