BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_J06 (644 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein Mam... 28 1.0 SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyce... 27 2.3 SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase Ub... 25 9.3 >SPAP11E10.02c |mam3|SPAPB1A10.01c|cell agglutination protein Mam3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1082 Score = 28.3 bits (60), Expect = 1.0 Identities = 26/93 (27%), Positives = 41/93 (44%) Frame = +1 Query: 100 VAKAKSSATMTARAISENLKHVCCLRTWSLLFRSAPICCTNLPASKLTHIKWFHSMRIWT 279 + AKSS + + I + V L+T S L S+PI ++L A+ + HS+ Sbjct: 530 LTNAKSSLSTPSTTIPTSNSSVS-LQTSSSLIISSPIISSSLTATSTSTPALTHSITPSN 588 Query: 280 LIGRTLIIERSQT*KDSFLNCACS*TXGEVMTT 378 + +I S T S L CS E+ +T Sbjct: 589 TSYTSSLIPSSSTDYSSSLITVCSNVTSEISST 621 >SPBC21D10.09c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1610 Score = 27.1 bits (57), Expect = 2.3 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 165 MLPTDLEPALSFCTHLLYKSAGIQADTYKMVSLNENLD 278 M+ +D EP +S C LL + D + MVS E + Sbjct: 1281 MVESDYEPDVSLCPELLSLAIDFPGDPFVMVSKMEKYE 1318 >SPBC713.02c |ubp21|ubpD, ubp15|ubiquitin C-terminal hydrolase Ubp21|Schizosaccharomyces pombe|chr 2|||Manual Length = 1129 Score = 25.0 bits (52), Expect = 9.3 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 194 KSRLQVRRQHTCLRFSDIALAVIVAEDF 111 K RLQ R + +FS + LAV+ A+ F Sbjct: 1055 KKRLQKRLGYNDTQFSKVKLAVLQAQSF 1082 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,283,444 Number of Sequences: 5004 Number of extensions: 40960 Number of successful extensions: 126 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -