BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_I24 (373 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 23 1.5 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 6.2 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 6.2 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 6.2 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 20 8.2 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 22.6 bits (46), Expect = 1.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 279 RKPSYGAEIMKKSNGCRGM 335 R P+Y AE+ K + C+G+ Sbjct: 100 RIPAYRAEVQKAISECKGI 118 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 20.6 bits (41), Expect = 6.2 Identities = 8/32 (25%), Positives = 19/32 (59%) Frame = -3 Query: 164 DIVGSRRDNTKHQYSQ*CERHKNTSICTNTRN 69 D++ + +DN + +Q + K +S+ +T+N Sbjct: 409 DLLTTEKDNNEIVTAQFLNQLKKSSVLVHTKN 440 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 20.6 bits (41), Expect = 6.2 Identities = 10/37 (27%), Positives = 15/37 (40%) Frame = +3 Query: 36 LHVSTQPANRNIPSVCANACVFMAFTLLRVLVLGVIA 146 L + N N+ + N C+ R L LG+ A Sbjct: 468 LMTTVNEGNNNMAATYMNECLLNIQKSPRTLTLGIFA 504 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 20.6 bits (41), Expect = 6.2 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 92 SICTNTRNITISGLRRDMQ 36 +IC R TISGL+R ++ Sbjct: 142 AICHPLRVYTISGLKRPIR 160 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 20.2 bits (40), Expect = 8.2 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +2 Query: 233 PRRPPPTLDAEDK 271 PR+ PP L DK Sbjct: 226 PRKAPPQLSTTDK 238 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,493 Number of Sequences: 438 Number of extensions: 1738 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8928360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -