BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_I15 (558 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24280.1 68418.m02856 expressed protein ; expression supporte... 33 0.098 At1g55350.4 68414.m06326 calpain-type cysteine protease family i... 29 2.8 At1g55350.3 68414.m06325 calpain-type cysteine protease family i... 29 2.8 At1g55350.2 68414.m06324 calpain-type cysteine protease family i... 29 2.8 At1g55350.1 68414.m06323 calpain-type cysteine protease family i... 29 2.8 At3g43530.1 68416.m04621 hypothetical protein contains Pfam prof... 28 4.9 At4g36105.1 68417.m05139 expressed protein 27 6.4 At1g54070.1 68414.m06161 dormancy/auxin associated protein-related 27 6.4 At5g28810.1 68418.m03542 hypothetical protein 27 8.5 At3g27970.1 68416.m03491 exonuclease family protein contains exo... 27 8.5 At1g50980.1 68414.m05731 F-box family protein contains F-box dom... 27 8.5 >At5g24280.1 68418.m02856 expressed protein ; expression supported by MPSS Length = 1634 Score = 33.5 bits (73), Expect = 0.098 Identities = 21/67 (31%), Positives = 35/67 (52%) Frame = +2 Query: 122 TLPEDEGEYTCEVDNGVGKPQKHSLKLTVVSAPKYEQKPEKVIVVKHGQDVTIPCKVTGL 301 +LPE+EG ++C V + + S+K+ V SAP E++ E H + T P +G+ Sbjct: 1199 SLPENEGVFSCRVFHSRYPELQMSIKIQVTSAPTSERE-ESGYSTPHSK--TTPPPESGI 1255 Query: 302 PAPKVVW 322 P+ W Sbjct: 1256 PSITNPW 1262 >At1g55350.4 68414.m06326 calpain-type cysteine protease family identical to calpain-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain family cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 Length = 2151 Score = 28.7 bits (61), Expect = 2.8 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 351 PPLRGFALWLQTTLGAGRPVTLHGIVTSCP 262 P ++GF LW+ L AG ++L I+++ P Sbjct: 757 PRIKGFILWICVVLFAGSVISLGAIISAKP 786 >At1g55350.3 68414.m06325 calpain-type cysteine protease family identical to calpain-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain family cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 Length = 2151 Score = 28.7 bits (61), Expect = 2.8 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 351 PPLRGFALWLQTTLGAGRPVTLHGIVTSCP 262 P ++GF LW+ L AG ++L I+++ P Sbjct: 757 PRIKGFILWICVVLFAGSVISLGAIISAKP 786 >At1g55350.2 68414.m06324 calpain-type cysteine protease family identical to calpain-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain family cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 Length = 2151 Score = 28.7 bits (61), Expect = 2.8 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 351 PPLRGFALWLQTTLGAGRPVTLHGIVTSCP 262 P ++GF LW+ L AG ++L I+++ P Sbjct: 757 PRIKGFILWICVVLFAGSVISLGAIISAKP 786 >At1g55350.1 68414.m06323 calpain-type cysteine protease family identical to calpain-like protein GI:20268660 from [Arabidopsis thaliana]; contains Pfam profiles: PF00648 Calpain family cysteine protease, PF01067 Calpain large subunit,domain III; identical to cDNA calpain-like protein GI:20268659 Length = 2151 Score = 28.7 bits (61), Expect = 2.8 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 351 PPLRGFALWLQTTLGAGRPVTLHGIVTSCP 262 P ++GF LW+ L AG ++L I+++ P Sbjct: 757 PRIKGFILWICVVLFAGSVISLGAIISAKP 786 >At3g43530.1 68416.m04621 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 615 Score = 27.9 bits (59), Expect = 4.9 Identities = 14/51 (27%), Positives = 22/51 (43%) Frame = +2 Query: 26 NYFKNGKDVNGNPEDRITRHNRTSGKRLLFKTTLPEDEGEYTCEVDNGVGK 178 N + G D NG +R R T + + + + GE E+D VG+ Sbjct: 427 NELEEGSDANGGDNEREVREKETEIDKEVAQGDNEREVGEKETEIDKEVGQ 477 >At4g36105.1 68417.m05139 expressed protein Length = 245 Score = 27.5 bits (58), Expect = 6.4 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +3 Query: 30 TSRMVRT*TETLKTVSPATIEPQASVFSS-RQHSQKTRANTLAKST 164 T R+V T E+LK A+ ++ SS R+H Q A +AKST Sbjct: 149 TERIVMTECESLKNALTASNNVLDTLLSSSRRHFQTIEARLVAKST 194 >At1g54070.1 68414.m06161 dormancy/auxin associated protein-related Length = 123 Score = 27.5 bits (58), Expect = 6.4 Identities = 22/68 (32%), Positives = 33/68 (48%), Gaps = 4/68 (5%) Frame = +2 Query: 161 DNGVGKPQKHSLKLTVVSAP---KYEQKPEKVIVVKHGQDVTIPCKVTGLP-APKVVWSH 328 DNG+GK +KH TV S+P +Q ++V K +V K+ P +P S+ Sbjct: 18 DNGLGKLRKHDSLSTVRSSPPSLSSDQVTRSIMVTKGNNNVRGLRKLKMDPDSPTCSSSN 77 Query: 329 NAKPLSGG 352 PL+ G Sbjct: 78 PGTPLTPG 85 >At5g28810.1 68418.m03542 hypothetical protein Length = 560 Score = 27.1 bits (57), Expect = 8.5 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 86 NRTSGKRLLFKTTLPEDEGEYTCEVDNGVGKPQKHSLKLTVVSAPKYE-QKPEK 244 N+ +G ++L K + + + + VGKP K +K TVV K + KPEK Sbjct: 440 NKEAGTKVLTKKKVAKSDKKKIIVNVEKVGKP-KPEMKKTVVKVEKVDSSKPEK 492 >At3g27970.1 68416.m03491 exonuclease family protein contains exonuclease domain, Pfam:PF00929 Length = 354 Score = 27.1 bits (57), Expect = 8.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 182 GVCRLHCRLRKCIRPRLLGVLS*RE 108 GVC+ HCR + +R L+G L +E Sbjct: 47 GVCKKHCRSFESLREHLIGPLPKQE 71 >At1g50980.1 68414.m05731 F-box family protein contains F-box domain Pfam:PF00646 Length = 370 Score = 27.1 bits (57), Expect = 8.5 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -1 Query: 384 MTRPLSLTVALPPLRGFALWLQTTLGAGRPVTLHGIVTSCP 262 +T + T+ +P LR L + T G RP +HG V + P Sbjct: 164 LTNVMIFTIDVPTLR--ILSIDNTSGKSRPKGVHGFVINTP 202 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,991,993 Number of Sequences: 28952 Number of extensions: 249389 Number of successful extensions: 690 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 690 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1062855648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -