BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_I14 (511 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6LFJ9 Cluster: Coatomer alpha subunit, putative; n=3; ... 33 5.0 UniRef50_Q896L3 Cluster: Conserved protein, phospholipase C rela... 32 8.7 >UniRef50_Q6LFJ9 Cluster: Coatomer alpha subunit, putative; n=3; Plasmodium|Rep: Coatomer alpha subunit, putative - Plasmodium falciparum (isolate 3D7) Length = 1537 Score = 32.7 bits (71), Expect = 5.0 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = +1 Query: 31 NVFIQIHNLAVLYYLKHIYNIISNAKYKLC--*ILECNFIYKSDIFATSVPKYYVFPPI 201 N+FIQ + L + H+YNI N K C I ECN+ K YY+ PPI Sbjct: 970 NIFIQQNQLNLALLCSHLYNIPINLSDKQCEFDINECNYCPKK--------SYYLCPPI 1020 >UniRef50_Q896L3 Cluster: Conserved protein, phospholipase C related; n=7; Clostridium|Rep: Conserved protein, phospholipase C related - Clostridium tetani Length = 242 Score = 31.9 bits (69), Expect = 8.7 Identities = 14/43 (32%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -3 Query: 476 KKFLRVF*TPFRYL-IQYTYLISLHQERENFNFFKDHLDNVNK 351 KKFL+ + T +++ +Q ++ + +E +NFFKD+L +N+ Sbjct: 25 KKFLKTYCTVHKFIMLQSLDILKNSEHQEAYNFFKDNLAKLNE 67 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 382,011,655 Number of Sequences: 1657284 Number of extensions: 6218603 Number of successful extensions: 13152 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13147 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 30946432294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -