BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_I14 (511 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1604.14c |shk1|pak1, orb2|PAK-related kinase Shk1|Schizosacc... 25 5.0 SPBC1604.05 |pgi1||glucose-6-phosphate isomerase |Schizosaccharo... 25 8.7 >SPBC1604.14c |shk1|pak1, orb2|PAK-related kinase Shk1|Schizosaccharomyces pombe|chr 2|||Manual Length = 658 Score = 25.4 bits (53), Expect = 5.0 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -1 Query: 262 DLLVINTIHHRSCTNFIMTF 203 ++LV+ + HH++ NFI TF Sbjct: 431 EILVMKSHHHKNIVNFIDTF 450 >SPBC1604.05 |pgi1||glucose-6-phosphate isomerase |Schizosaccharomyces pombe|chr 2|||Manual Length = 550 Score = 24.6 bits (51), Expect = 8.7 Identities = 13/46 (28%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +2 Query: 101 MLSINFVEYWNVTLYINQIYSQ--HRFPNIMYFLLLKCHNKVRTRS 232 ++SI + +++ ++ Y Q HRFP + L ++ + K TRS Sbjct: 327 LISIWYSDFFGAQTHLVAPYDQYLHRFPAYLQQLSMESNGKAITRS 372 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,756,427 Number of Sequences: 5004 Number of extensions: 30893 Number of successful extensions: 74 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 204242806 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -