BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_I14 (511 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0213 + 6480521-6480644,6482347-6482499,6482582-6482980,648... 28 5.0 03_02_0913 + 12344096-12344125,12344284-12345970,12346243-123465... 27 8.8 >03_02_0213 + 6480521-6480644,6482347-6482499,6482582-6482980, 6483158-6483234,6483990-6485312 Length = 691 Score = 27.9 bits (59), Expect = 5.0 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 256 LVINTIHHRSCTNFIMTFQ*EEIHNIWEPMLR 161 +V+ I H +C I + EE+ NIW+ ++R Sbjct: 102 IVMKGIKHGACDYLIKPVRMEELKNIWQHVIR 133 >03_02_0913 + 12344096-12344125,12344284-12345970,12346243-12346573, 12346712-12347567,12347760-12347883,12348469-12348688, 12348771-12349229,12349318-12349519 Length = 1302 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 28 KNVFIQIHNLAVLYYL 75 KN+FIQ H LA +Y+L Sbjct: 178 KNLFIQFHRLAYVYFL 193 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,359,933 Number of Sequences: 37544 Number of extensions: 141849 Number of successful extensions: 267 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 267 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1095026320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -