BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_I13 (560 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 36 2e-04 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 31 0.009 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 26 0.19 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 26 0.19 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 26 0.19 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.1 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 5.5 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 9.6 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 9.6 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 35.9 bits (79), Expect = 2e-04 Identities = 14/47 (29%), Positives = 28/47 (59%) Frame = +1 Query: 334 TALRDPAFYQLYXRIVGYINAFKHYLKPYPQEKLHFVGVXINDVVVE 474 TA+RDP FY+ + I +K L Y + +L++ G+ ++++ V+ Sbjct: 392 TAMRDPIFYRWHSYIDDIFQEYKATLPRYTENQLNYPGITVSNIEVQ 438 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 30.7 bits (66), Expect = 0.009 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = +1 Query: 340 LRDPAFYQLYXRIVGYINAFKHYLKPYPQEKLHFVGVXINDVVVE 474 LRDP F++ + I FK L Y +L++ GV + ++ V+ Sbjct: 394 LRDPLFFRWHAYIDDMFQEFKATLPRYTVAQLNYPGVTVTNIEVQ 438 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 26.2 bits (55), Expect = 0.19 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 350 LHSISYXTGLWVTLTHSSIT 409 +H+ SY TG+WV L + S T Sbjct: 123 IHTSSYMTGIWVWLINISAT 142 Score = 21.8 bits (44), Expect = 4.1 Identities = 11/46 (23%), Positives = 18/46 (39%) Frame = +2 Query: 254 VLAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHSISYXTGLWVTL 391 ++AMC + + + + S P L F P L W+ L Sbjct: 177 LIAMCGMYYRDECSFAESIPPYLFFVPPPLMFLQDFLSHQHAWIWL 222 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 26.2 bits (55), Expect = 0.19 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 350 LHSISYXTGLWVTLTHSSIT 409 +H+ SY TG+WV L + S T Sbjct: 356 IHTSSYMTGIWVWLINISAT 375 Score = 21.8 bits (44), Expect = 4.1 Identities = 11/46 (23%), Positives = 18/46 (39%) Frame = +2 Query: 254 VLAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHSISYXTGLWVTL 391 ++AMC + + + + S P L F P L W+ L Sbjct: 410 LIAMCGMYYRDECSFAESIPPYLFFVPPPLMFLQDFLSHQHAWIWL 455 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 26.2 bits (55), Expect = 0.19 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 350 LHSISYXTGLWVTLTHSSIT 409 +H+ SY TG+WV L + S T Sbjct: 356 IHTSSYMTGIWVWLINISAT 375 Score = 21.8 bits (44), Expect = 4.1 Identities = 11/46 (23%), Positives = 18/46 (39%) Frame = +2 Query: 254 VLAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHSISYXTGLWVTL 391 ++AMC + + + + S P L F P L W+ L Sbjct: 410 LIAMCGMYYRDECSFAESIPPYLFFVPPPLMFLQDFLSHQHAWIWL 455 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 394 AFKHYLKPYPQEKLHFVGVXI 456 AF H+L + E LH VG+ + Sbjct: 163 AFSHFLIVFFTETLHTVGIAL 183 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 394 AFKHYLKPYPQEKLHFVGVXI 456 AF H+L + E LH VG+ + Sbjct: 163 AFSHFLIVFFTETLHTVGIAL 183 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 394 AFKHYLKPYPQEKLHFVGVXI 456 AF H+L + E LH VG+ + Sbjct: 163 AFSHFLIVFFTETLHTVGIAL 183 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 394 AFKHYLKPYPQEKLHFVGVXI 456 AF H+L + E LH VG+ + Sbjct: 163 AFSHFLIVFFTETLHTVGIAL 183 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 3.1 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -2 Query: 541 LFWSRIHC*W 512 LFW++ HC W Sbjct: 2269 LFWNKDHCDW 2278 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.4 bits (43), Expect = 5.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 235 IILCNFFFIQIGVLLPIVSDKVNCLFIV 152 I C FF I +LL I + LFI+ Sbjct: 407 ITACKFFSIDNALLLSICGASSSYLFIM 434 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +1 Query: 427 EKLHFVGVXINDVVVEKLVTFFDYS 501 EK+ + N++V +++ F DY+ Sbjct: 134 EKIQALDPSTNELVFSEVLLFLDYN 158 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -1 Query: 167 LPFHRGNQFSCHTIRICL 114 + FH G+Q HT++ L Sbjct: 378 ITFHIGSQLVLHTVKTVL 395 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,575 Number of Sequences: 336 Number of extensions: 2657 Number of successful extensions: 16 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -