BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_I13 (560 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4B4.09 |usp105|prp39|U1 snRNP-associated protein Usp105|Schi... 30 0.27 SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces ... 28 1.1 SPBC1271.01c |pof13||F-box protein Pof13|Schizosaccharomyces pom... 27 2.5 SPCC622.12c |||NADP-specific glutamate dehydrogenase |Schizosacc... 26 3.3 SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosacchar... 26 3.3 SPCC594.05c |||COMPASS complex subunit |Schizosaccharomyces pomb... 25 7.6 >SPBC4B4.09 |usp105|prp39|U1 snRNP-associated protein Usp105|Schizosaccharomyces pombe|chr 2|||Manual Length = 612 Score = 29.9 bits (64), Expect = 0.27 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 3/70 (4%) Frame = +2 Query: 74 LDIFEKTFVQSLQKGKFESYGKKIDFHDEKAINFVGNYWQENADLYEEEVTKDYQR---S 244 L IF+K +++ ++ FES K+ FH ++ W++ D EEV D+QR Sbjct: 247 LQIFQKVQLETAKRWTFESEIKRPYFHVKELDEAQLVNWRKYLDF--EEVEGDFQRICHL 304 Query: 245 YEIVLAMCSV 274 YE L C++ Sbjct: 305 YERCLITCAL 314 >SPAC664.10 |klp2||kinesin-like protein Klp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 817 Score = 27.9 bits (59), Expect = 1.1 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +2 Query: 68 RFLDIFEKTFVQSLQKGKFESYG-KKID-FHDEKA 166 +FL+I+ +T + L G E G KK++ +HD KA Sbjct: 606 QFLEIYNETIIDLLASGNEEEKGKKKLEIYHDTKA 640 >SPBC1271.01c |pof13||F-box protein Pof13|Schizosaccharomyces pombe|chr 2|||Manual Length = 396 Score = 26.6 bits (56), Expect = 2.5 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 420 IRLQVMLECVNVTH-NPVI*LIECRVSKCGLVKVKRTGHEGVLVEWF 283 I Q L+ + TH NPV EC +S+C L K G E L + F Sbjct: 233 ILFQNALDALPTTHGNPV----ECDISRCPLNACKIAGQETELADLF 275 >SPCC622.12c |||NADP-specific glutamate dehydrogenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 451 Score = 26.2 bits (55), Expect = 3.3 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +1 Query: 346 DPAFYQLYXRIVGYINAFKHYLKPYPQEKLHFVGVXINDVVVEKLVTFFD 495 +P F Q Y IVG I + K + + +P+ K + I + V+E VT+ D Sbjct: 6 EPEFQQAYKEIVGSIESSKLF-EVHPELKRVLPIISIPERVLEFRVTWED 54 >SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosaccharomyces pombe|chr 3|||Manual Length = 902 Score = 26.2 bits (55), Expect = 3.3 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +2 Query: 278 HLNHSTSTPSCPVRLTF--TKPHFETLHSISYXTGLWVTLT 394 HL S STPS LTF T + T H LW L+ Sbjct: 605 HLIDSISTPSVCTSLTFAPTGDYLATTHVDQVGISLWTNLS 645 >SPCC594.05c |||COMPASS complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 424 Score = 25.0 bits (52), Expect = 7.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 86 EKTFVQSLQKGKFESYGKKIDFHDEKAIN 172 EKT V+S+ K + + G DFH E A N Sbjct: 12 EKTHVESIVKFEDSNRGTITDFHIETANN 40 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,208,851 Number of Sequences: 5004 Number of extensions: 44558 Number of successful extensions: 135 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 135 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 236012634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -