BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_I11 (511 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein si... 57 6e-09 At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein si... 57 8e-09 At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein si... 51 5e-07 At4g19750.1 68417.m02899 glycosyl hydrolase family 18 protein si... 50 9e-07 At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein si... 47 8e-06 At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein si... 47 8e-06 At4g19740.1 68417.m02898 glycosyl hydrolase family 18 protein si... 47 8e-06 At4g19760.1 68417.m02900 glycosyl hydrolase family 18 protein si... 44 6e-05 At4g19720.1 68417.m02896 glycosyl hydrolase family 18 protein si... 43 1e-04 At3g16460.2 68416.m02097 jacalin lectin family protein contains ... 31 0.60 At3g16460.1 68416.m02098 jacalin lectin family protein contains ... 31 0.60 At1g30220.1 68414.m03697 sugar transporter family protein simila... 29 1.4 At5g42390.1 68418.m05161 metalloendopeptidase identical to chlor... 29 2.4 At4g34350.1 68417.m04881 LytB family protein contains Pfam profi... 28 3.2 At4g02680.1 68417.m00363 tetratricopeptide repeat (TPR)-containi... 27 5.5 At1g50790.1 68414.m05712 hypothetical protein 27 5.5 At2g33570.1 68415.m04114 expressed protein 27 7.3 At5g17920.1 68418.m02101 5-methyltetrahydropteroyltriglutamate--... 27 9.7 At2g43330.1 68415.m05388 sugar transporter family protein simila... 27 9.7 >At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 379 Score = 57.2 bits (132), Expect = 6e-09 Identities = 39/126 (30%), Positives = 62/126 (49%), Gaps = 1/126 (0%) Frame = +2 Query: 17 REGFTALVREMKQALNVKPNMQLVISVLPNVNS-SIYFDVPSIINLVDIVNIQAFDYYTP 193 RE +A+V E + KP + L +V + N S+ + V ++ + +D VN+ A+D+Y P Sbjct: 156 REWRSAVVAEASSS--GKPRLLLAAAVFYSNNYYSVLYPVSAVASSLDWVNLMAYDFYGP 213 Query: 194 ERNPKEADYTAPIYAPQNRDPLQNADAAINYWIQNGAPTHKLVLGISTTGRTWKLDSDSE 373 + + A ++ P N P + DA WIQ G P K VLG G W+L + + Sbjct: 214 GWS-RVTGPPAALFDPSNAGP--SGDAGTRSWIQAGLPAKKAVLGFPYYGYAWRLTNANS 270 Query: 374 ISGVPP 391 S P Sbjct: 271 HSYYAP 276 >At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:505267 from [Nicotiana tabacum] Length = 332 Score = 56.8 bits (131), Expect = 8e-09 Identities = 33/111 (29%), Positives = 55/111 (49%), Gaps = 1/111 (0%) Frame = +2 Query: 44 EMKQALNVKPNMQLVISVL-PNVNSSIYFDVPSIINLVDIVNIQAFDYYTPERNPKEADY 220 E + + KP + L +V +V + + V + +D VNI A+D+Y P + K Sbjct: 154 EAESRRSSKPTLLLTAAVYYSSVYKTFTYPVQVMRESLDWVNIIAYDFYGPVSSSKFTVP 213 Query: 221 TAPIYAPQNRDPLQNADAAINYWIQNGAPTHKLVLGISTTGRTWKLDSDSE 373 TA ++ N + + D+ + WI++G P K VLG S G W L +D + Sbjct: 214 TAGLHVSSNNEG-PSGDSGLKQWIKDGLPEKKAVLGFSYVGWAWTLQNDKD 263 >At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 366 Score = 50.8 bits (116), Expect = 5e-07 Identities = 42/155 (27%), Positives = 69/155 (44%), Gaps = 7/155 (4%) Frame = +2 Query: 20 EGFTALVREMKQALNV------KPNMQLVISVLPNVNS-SIYFDVPSIINLVDIVNIQAF 178 + F L+RE + A+ KP + L +V + + S+ V ++ + +D VN+ A+ Sbjct: 147 DNFGKLLREWRLAVEAEARSSGKPRLLLTAAVFYSYSYYSVLHPVNAVADSLDWVNLVAY 206 Query: 179 DYYTPERNPKEADYTAPIYAPQNRDPLQNADAAINYWIQNGAPTHKLVLGISTTGRTWKL 358 D+Y + + AP+Y P P + DA + W Q G P K VLG G W L Sbjct: 207 DFYE-SGSSRVTCSPAPLYDPITTGP--SGDAGVRAWTQAGLPAKKAVLGFPLYGYAWCL 263 Query: 359 DSDSEISGVPPIHADXGGEAGPYTKVQGLLSYPEI 463 +D++ H +GP G + Y +I Sbjct: 264 -TDAK------NHNYYANSSGPAISPDGSIGYDQI 291 >At4g19750.1 68417.m02899 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 362 Score = 50.0 bits (114), Expect = 9e-07 Identities = 28/86 (32%), Positives = 47/86 (54%) Frame = +2 Query: 125 FDVPSIINLVDIVNIQAFDYYTPERNPKEADYTAPIYAPQNRDPLQNADAAINYWIQNGA 304 + V +I + +D VNI A+D+Y P +P A ++ P N ++ D+ ++ W++ Sbjct: 179 YPVQAIADNLDFVNIMAYDFYGPGWSPVTGP-PAALFDPSNPAG-RSGDSGLSKWLEAKL 236 Query: 305 PTHKLVLGISTTGRTWKLDSDSEISG 382 P K VLG S G W L+ D+E +G Sbjct: 237 PAKKAVLGFSYCGWAWTLE-DAENNG 261 >At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 398 Score = 46.8 bits (106), Expect = 8e-06 Identities = 40/161 (24%), Positives = 69/161 (42%), Gaps = 7/161 (4%) Frame = +2 Query: 2 KESEHREGFTALVREMKQALNVKPNMQLVISVLPNVN---SSIYFDVP----SIINLVDI 160 + E F L+ E + A+ + N +++ SS Y VP +I N +D Sbjct: 122 RNEEEMYDFGKLLEEWRSAVEAESNSSGTTALILTAAVYYSSNYQGVPYPVLAISNSLDW 181 Query: 161 VNIQAFDYYTPERNPKEADYTAPIYAPQNRDPLQNADAAINYWIQNGAPTHKLVLGISTT 340 +N+ A+D+Y P + A +Y P + ++ D+ + W + G P K VLG Sbjct: 182 INLMAYDFYGPGWSTVTGP-PASLYLPTDG---RSGDSGVRDWTEAGLPAKKAVLGFPYY 237 Query: 341 GRTWKLDSDSEISGVPPIHADXGGEAGPYTKVQGLLSYPEI 463 G W L +D +++G GP G +SY ++ Sbjct: 238 GWAWTL-ADPDVNGY------DANTTGPAISDDGEISYRQL 271 >At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 261 Score = 46.8 bits (106), Expect = 8e-06 Identities = 36/120 (30%), Positives = 49/120 (40%) Frame = +2 Query: 104 NVNSSIYFDVPSIINLVDIVNIQAFDYYTPERNPKEADYTAPIYAPQNRDPLQNADAAIN 283 N N +Y V I L+D VNI+A+D+Y P + T P A + + D+ + Sbjct: 77 NYNGVVY-PVKFISELLDWVNIKAYDFY----GPGCTEVTGPPAALYLQSDGPSGDSGVK 131 Query: 284 YWIQNGAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADXGGEAGPYTKVQGLLSYPEI 463 WI G P K VLG G W L P H GP G +SY ++ Sbjct: 132 DWIDAGLPAEKAVLGFPYYGWAWTLAD-------PKNHGYYVDTTGPAISDDGEISYSQL 184 >At4g19740.1 68417.m02898 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 289 Score = 46.8 bits (106), Expect = 8e-06 Identities = 29/109 (26%), Positives = 50/109 (45%), Gaps = 2/109 (1%) Frame = +2 Query: 53 QALNVKPNMQLVISVLPNVNSSIYFDVPSIINLVDIVNIQAFDYY--TPERNPKEADYTA 226 Q ++P + + +S+ + V +I +D VN+ A+++Y T E P A Sbjct: 137 QRTGIRPLLLTAAVYYTSDYNSVSYPVQAINRSLDWVNLIAYEFYGLTTEIGPP-----A 191 Query: 227 PIYAPQNRDPLQNADAAINYWIQNGAPTHKLVLGISTTGRTWKLDSDSE 373 +Y P + P D + +W++ G P K V G G +W LD D + Sbjct: 192 GLYDPSIKGPC--GDTGLKHWLKAGLPEKKAVFGFPYVGWSWTLDDDKD 238 >At4g19760.1 68417.m02900 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:505267 from [Nicotiana tabacum] Length = 365 Score = 44.0 bits (99), Expect = 6e-05 Identities = 32/122 (26%), Positives = 52/122 (42%), Gaps = 1/122 (0%) Frame = +2 Query: 20 EGFTALVREMKQALNVKPNMQLVISVLPNVNSSIYFDVPSIINLVDIVNIQAFDYYTPER 199 E + A V E N P + + + V +I + +D VNI A+D+Y P Sbjct: 152 EEWRAAVVEESDKTNQLPLLLTAAVYYSPQYDGVEYPVKAIADNLDFVNIMAYDFYGPGW 211 Query: 200 NPKEADYTAPIYAPQNRDPLQNADAAINYWIQNG-APTHKLVLGISTTGRTWKLDSDSEI 376 +P A + P N ++ ++ + W+ P K VLG G W L+ D+E Sbjct: 212 SPVTGPPAALFHDPSN-PAGRSGNSGLRKWLDEAKLPPKKAVLGFPYCGWAWTLE-DAEN 269 Query: 377 SG 382 +G Sbjct: 270 NG 271 >At4g19720.1 68417.m02896 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 363 Score = 43.2 bits (97), Expect = 1e-04 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 1/90 (1%) Frame = +2 Query: 107 VNSSIYFDVPSIINLVDIVNIQAFDYYTPERNPKEADYTAPIYAPQN-RDPLQNADAAIN 283 V S+ + + I +D VN+ A+D+Y+ A ++ P N + P D + Sbjct: 174 VYDSVSYPIREIKKKLDWVNLIAYDFYSSSTT---IGPPAALFDPSNPKGPC--GDYGLK 228 Query: 284 YWIQNGAPTHKLVLGISTTGRTWKLDSDSE 373 WI+ G P K VLG G TW L S ++ Sbjct: 229 EWIKAGLPAKKAVLGFPYVGWTWSLGSGND 258 >At3g16460.2 68416.m02097 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase binding protein [Brassica napus] GI:1711296, GI:1655824, myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin family Length = 647 Score = 30.7 bits (66), Expect = 0.60 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 299 GAPTHKL-VLGISTTGRTWKLDSDSEISGVPPIHADXGGEAGPYTK 433 G+ KL G ST G +W D S+ GV I+A GGE Y K Sbjct: 249 GSGAQKLEAQGNSTGGTSW--DDGSDYDGVTKIYASYGGEGIQYVK 292 >At3g16460.1 68416.m02098 jacalin lectin family protein contains Pfam profile: PF01419 jacalin-like lectin domain; similar to myrosinase binding protein [Brassica napus] GI:1711296, GI:1655824, myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin family Length = 705 Score = 30.7 bits (66), Expect = 0.60 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 299 GAPTHKL-VLGISTTGRTWKLDSDSEISGVPPIHADXGGEAGPYTK 433 G+ KL G ST G +W D S+ GV I+A GGE Y K Sbjct: 249 GSGAQKLEAQGNSTGGTSW--DDGSDYDGVTKIYASYGGEGIQYVK 292 >At1g30220.1 68414.m03697 sugar transporter family protein similar to SP|Q96QE2 Proton myo-inositol co-transporter (Hmit) [Homo sapiens]; contains Pfam profile PF00083: major facilitator superfamily protein Length = 580 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +3 Query: 252 ILYKTPTLL*ITGFKMVRLPTNLSLVSAPLDVRGSSI 362 ++Y +PT++ + GF R LSLV+A L+ GS I Sbjct: 294 VMYYSPTIVQLAGFASNRTALLLSLVTAGLNAFGSII 330 >At5g42390.1 68418.m05161 metalloendopeptidase identical to chloroplast processing enzyme metalloendopeptidase [Arabidopsis thaliana] gi|2827039|gb|AAC39482 Length = 1265 Score = 28.7 bits (61), Expect = 2.4 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = -1 Query: 181 VKCLDVDNVDQVYDAWDVKVNGAIYVWQNADN*LHIGFYIECLF 50 +K DVD + + ++ W N +Y+ + DN I IE +F Sbjct: 358 IKKWDVDKIRKFHERWYFPANATLYIVGDIDNIPRIVHNIEAVF 401 >At4g34350.1 68417.m04881 LytB family protein contains Pfam profile: PF02401 LytB protein Length = 466 Score = 28.3 bits (60), Expect = 3.2 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +2 Query: 317 LVLGISTTGRTWKLDSDSEISGVPPIHADXGGEAGPYTKVQGLLSYPEICAK 472 LV+G + T L SE G+P D GP K+ L Y E+ K Sbjct: 372 LVVGGWNSSNTSHLQEISEARGIPSYWIDSEKRIGPGNKIAYKLHYGELVEK 423 >At4g02680.1 68417.m00363 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 888 Score = 27.5 bits (58), Expect = 5.5 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 11 EHREGFTALVREMKQALNVKPNMQLVISVLPNVNS 115 EH T+ +R+ + AL+V PN Q ++ + VNS Sbjct: 851 EHIGDVTSALRDCRAALSVDPNHQEMLELHSRVNS 885 >At1g50790.1 68414.m05712 hypothetical protein Length = 812 Score = 27.5 bits (58), Expect = 5.5 Identities = 15/73 (20%), Positives = 32/73 (43%) Frame = +2 Query: 71 PNMQLVISVLPNVNSSIYFDVPSIINLVDIVNIQAFDYYTPERNPKEADYTAPIYAPQNR 250 P ++++PN + + I + +V I + ++Y P R + ++ P NR Sbjct: 339 PEKATWVTLVPNRDDE-FISFARCIMVSQLVGIDSLEHYYPNRVASQFGRLQDVHCPVNR 397 Query: 251 DPLQNADAAINYW 289 + L A +Y+ Sbjct: 398 NNLSREAAWNDYY 410 >At2g33570.1 68415.m04114 expressed protein Length = 496 Score = 27.1 bits (57), Expect = 7.3 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -3 Query: 263 FVEDRGSAVRKSVQCSPPLWGYVQVYNSQMPGC 165 ++ + G+++R Q P WGY +VY + C Sbjct: 147 WISNNGTSIRAKAQKILPDWGYGRVYTVVVVNC 179 >At5g17920.1 68418.m02101 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase / vitamin-B12-independent methionine synthase / cobalamin-independent methionine synthase (CIMS) identical to SP|O50008 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase (EC 2.1.1.14) (Vitamin-B12-independent methionine synthase isozyme) (Cobalamin-independent methionine synthase isozyme) {Arabidopsis thaliana} Length = 765 Score = 26.6 bits (56), Expect = 9.7 Identities = 15/53 (28%), Positives = 23/53 (43%) Frame = +2 Query: 263 NADAAINYWIQNGAPTHKLVLGISTTGRTWKLDSDSEISGVPPIHADXGGEAG 421 +AD + W Q A K + + LD+ + + VPP + GGE G Sbjct: 38 SADLRSSIWKQMSAAGTKFIPSNTFAHYDQVLDTTAMLGAVPPRYGYTGGEIG 90 >At2g43330.1 68415.m05388 sugar transporter family protein similar to SP|Q96QE2 Proton myo-inositol co-transporter (Hmit) [Homo sapiens], SP|Q01440 Membrane transporter D1 {Leishmania donovani}; contains Pfam profile PF00083: major facilitator superfamily protein Length = 509 Score = 26.6 bits (56), Expect = 9.7 Identities = 11/37 (29%), Positives = 23/37 (62%) Frame = +3 Query: 252 ILYKTPTLL*ITGFKMVRLPTNLSLVSAPLDVRGSSI 362 ++Y +PT++ + GF +L LSL+ A ++ G+ + Sbjct: 294 VMYYSPTIVQMAGFHSNQLALFLSLIVAAMNAAGTVV 330 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,461,356 Number of Sequences: 28952 Number of extensions: 240930 Number of successful extensions: 682 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 674 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 917929344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -