BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_I09 (469 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10616| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) 28 4.4 SB_37175| Best HMM Match : GvpH (HMM E-Value=2.5) 28 4.4 SB_33930| Best HMM Match : Ligase_CoA (HMM E-Value=0) 28 4.4 SB_10131| Best HMM Match : Ligase_CoA (HMM E-Value=0) 28 4.4 >SB_10616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 856 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = -3 Query: 278 TVKADVRELAADGDSFVFSTNVLQLTGFLGLLSIAGLNSVAVS 150 +V +V + +DGD V LTGFLG S G +S A S Sbjct: 810 SVDQNVNQATSDGDGSVVGFLKTSLTGFLGPSSSEGTSSSAAS 852 >SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) Length = 3037 Score = 27.9 bits (59), Expect = 4.4 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 126 DNDNIGVEGYSYAVETSDGK-QAQETGQLKNVGTENE 233 DND++ E S ++ SDGK +Q G+ N T N+ Sbjct: 1749 DNDHVDKERASTPIDNSDGKPNSQSQGRTSNQPTLNQ 1785 >SB_37175| Best HMM Match : GvpH (HMM E-Value=2.5) Length = 340 Score = 27.9 bits (59), Expect = 4.4 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 126 DNDNIGVEGYSYAVETSDGK-QAQETGQLKNVGTENE 233 DND++ E S ++ SDGK +Q G+ N T N+ Sbjct: 180 DNDHVDKERASTPIDNSDGKPNSQSQGRTSNQPTLNQ 216 >SB_33930| Best HMM Match : Ligase_CoA (HMM E-Value=0) Length = 755 Score = 27.9 bits (59), Expect = 4.4 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 216 VGTENEAISVRGQFSYVGLDGVTYTVTYTADEEGFKPSGAHLPQS 350 +GT + QF + G + T A + K SGAH+P S Sbjct: 295 IGTCANMFTSEVQFGHAGASAHSNIETAVAKNKALKSSGAHVPDS 339 >SB_10131| Best HMM Match : Ligase_CoA (HMM E-Value=0) Length = 609 Score = 27.9 bits (59), Expect = 4.4 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 216 VGTENEAISVRGQFSYVGLDGVTYTVTYTADEEGFKPSGAHLPQS 350 +GT + QF + G + T A + K SGAH+P S Sbjct: 444 IGTCANMFTSEVQFGHAGASAHSNIETAVAKNKALKSSGAHVPDS 488 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,156,443 Number of Sequences: 59808 Number of extensions: 165304 Number of successful extensions: 429 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 969807871 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -