BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_I09 (469 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 58 6e-11 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.54 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.54 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 5.0 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 5.0 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 5.0 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 57.6 bits (133), Expect = 6e-11 Identities = 33/82 (40%), Positives = 45/82 (54%), Gaps = 1/82 (1%) Frame = +3 Query: 102 KDATIVRYDNDNIGVEG-YSYAVETSDGKQAQETGQLKNVGTENEAISVRGQFSYVGLDG 278 KDA I + + +G Y ETS+G QE+GQ K V E +S +G SY DG Sbjct: 25 KDAVITSQQLE-VNFDGNYINNFETSNGISHQESGQPKQVDNETPVVS-QGSDSYTAPDG 82 Query: 279 VTYTVTYTADEEGFKPSGAHLP 344 ++TY ADE GF+ G+H+P Sbjct: 83 QQVSITYVADENGFQVQGSHIP 104 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.6 bits (51), Expect = 0.54 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +3 Query: 255 FSYVGLDGVTYTVTYTADEEGFKPSGAHLPQSVSA 359 F+ VG DGV TVTY EE S A + VS+ Sbjct: 1193 FTRVG-DGVPTTVTYCQTEEDVPGSPADIKVVVSS 1226 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.6 bits (51), Expect = 0.54 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = +3 Query: 255 FSYVGLDGVTYTVTYTADEEGFKPSGAHLPQSVSA 359 F+ VG DGV TVTY EE S A + VS+ Sbjct: 1189 FTRVG-DGVPTTVTYCQTEEDVPGSPADIKVVVSS 1222 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 5.0 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +2 Query: 326 QRCPPPP 346 +RCPPPP Sbjct: 1699 RRCPPPP 1705 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.4 bits (43), Expect = 5.0 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -1 Query: 154 YPSTPMLSLS*RTMVASLDSRG 89 +PSTP++ S + A++D +G Sbjct: 131 HPSTPIVYASCKLQAAAVDHQG 152 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 5.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 138 IGVEGYSYAVETSDGKQAQETGQL 209 IG +G+S SDG +A+ G L Sbjct: 373 IGSDGWSARGLVSDGNEAEVEGTL 396 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 97,100 Number of Sequences: 438 Number of extensions: 1280 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12559158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -