BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_I03 (545 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6379| Best HMM Match : Proteasome (HMM E-Value=0) 266 6e-72 SB_24524| Best HMM Match : Proteasome (HMM E-Value=1.4013e-45) 79 3e-15 SB_58684| Best HMM Match : AMP-binding (HMM E-Value=0.36) 29 2.5 SB_4103| Best HMM Match : Proteasome (HMM E-Value=8.2e-05) 29 3.3 SB_5367| Best HMM Match : wnt (HMM E-Value=0) 28 5.7 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_6379| Best HMM Match : Proteasome (HMM E-Value=0) Length = 909 Score = 266 bits (653), Expect = 6e-72 Identities = 117/170 (68%), Positives = 145/170 (85%) Frame = +2 Query: 35 FNQDYKMSILAYNGGAVVAMKGQDCVAIATDKRFGIQAQTVSTNFPKVFQMGPTLYVGLP 214 F ++ MSI+ YNG A++AM G++CVAIA D+R GIQAQTVS +F K+FQMG L+VGLP Sbjct: 65 FRKEAVMSIMEYNGAAIIAMVGKNCVAIAADRRLGIQAQTVSCDFQKIFQMGEKLFVGLP 124 Query: 215 GLATDTQTVLQRLKFRMNLYELKENRIMKPKTFSAMLSNLLYEKRFGPYFIEPVIAGLDP 394 GLATD QT+ RLKFR+NLYEL+E R +KPKTF +M+SNLLYE+RFGPYF+EPVIAGLDP Sbjct: 125 GLATDVQTISSRLKFRLNLYELREGRPIKPKTFLSMVSNLLYERRFGPYFVEPVIAGLDP 184 Query: 395 YDNTPYVCNMDLIGCPNEPEDFVVSGTCSEQLYGMCEALWEPNLKPDELF 544 N P++ +MDLIGCP E +DFVVSGTCSEQ+YGMCE+LW P+L+PD+LF Sbjct: 185 KTNEPFISSMDLIGCPMETKDFVVSGTCSEQMYGMCESLWVPDLEPDDLF 234 >SB_24524| Best HMM Match : Proteasome (HMM E-Value=1.4013e-45) Length = 291 Score = 78.6 bits (185), Expect = 3e-15 Identities = 45/142 (31%), Positives = 74/142 (52%) Frame = +2 Query: 65 AYNGGAVVAMKGQDCVAIATDKRFGIQAQTVSTNFPKVFQMGPTLYVGLPGLATDTQTVL 244 A+NGG V+A+ G+D IA+D R Q + + PKV+++ + +G G D T+ Sbjct: 84 AFNGGTVLAISGEDFAVIASDTRLSQGFQIHTRDSPKVYKLTGSTVLGCSGFHGDCLTLT 143 Query: 245 QRLKFRMNLYELKENRIMKPKTFSAMLSNLLYEKRFGPYFIEPVIAGLDPYDNTPYVCNM 424 + + R+ +YE + M + MLS +LY +RF PY+ ++AGLD + V + Sbjct: 144 KHISARLQMYEHDHGKAMSCTAIAQMLSTMLYYRRFFPYYTYNILAGLDS-EGKGCVFSF 202 Query: 425 DLIGCPNEPEDFVVSGTCSEQL 490 D +G E E + G+ S L Sbjct: 203 DPVG-SYEREVYRAGGSASALL 223 >SB_58684| Best HMM Match : AMP-binding (HMM E-Value=0.36) Length = 237 Score = 29.1 bits (62), Expect = 2.5 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -3 Query: 519 GSQRASHIPYNCSEHVPDTTKSSGSLGQPIKSILQTYGVLS 397 GS SH+P N + V SSG+ G P +L Y ++S Sbjct: 128 GSAFPSHVPVNWKQDVAYILYSSGTTGLPKGVLLTHYNLIS 168 >SB_4103| Best HMM Match : Proteasome (HMM E-Value=8.2e-05) Length = 131 Score = 28.7 bits (61), Expect = 3.3 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +2 Query: 374 VIAGLDPYDNTPYVCNMDLIG-CPNEPEDFVVSGTCSEQLYGMCEALWEPNLKPDELF 544 + AG D N V ++ L G C +P F + G+ S +YG C+A ++ + +E F Sbjct: 30 ICAGWDKL-NGGQVYSIPLGGMCIRQP--FTIGGSGSTYIYGHCDATYKSGMSKEECF 84 >SB_5367| Best HMM Match : wnt (HMM E-Value=0) Length = 367 Score = 27.9 bits (59), Expect = 5.7 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 241 HGLCVSCKTREPNI*CWSHLKHFRKVG 161 HG+C SC + CW L FR++G Sbjct: 217 HGVCGSCNLKT----CWRQLVEFREIG 239 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -1 Query: 527 SDWVPRGLHTFRTIVPSMFQTLQNPRAHWGNRSNPY 420 S W+ RG+H + P L+ P W + S PY Sbjct: 25 SSWLARGVHASNSCSPGDPLVLERPPPRWSSNS-PY 59 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,652,078 Number of Sequences: 59808 Number of extensions: 414467 Number of successful extensions: 1102 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 992 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1102 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -