BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_H23 (540 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-5|CAJ14156.1| 227|Anopheles gambiae predicted protein ... 23 5.0 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 6.5 >CR954257-5|CAJ14156.1| 227|Anopheles gambiae predicted protein protein. Length = 227 Score = 23.4 bits (48), Expect = 5.0 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -2 Query: 227 LFKSPKPAITNPHLKAGAQKNIVFGPASCS 138 LF P + +P+L+ + V+ P CS Sbjct: 37 LFAFPADVVVSPNLENARNRTPVYIPGKCS 66 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.0 bits (47), Expect = 6.5 Identities = 9/34 (26%), Positives = 18/34 (52%) Frame = -2 Query: 209 PAITNPHLKAGAQKNIVFGPASCSHSGRILDGTN 108 P +++ + Q+ ++ P+S HS +L G N Sbjct: 78 PVLSSSAQQQQQQQQLLHHPSSSPHSNHLLGGPN 111 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 525,749 Number of Sequences: 2352 Number of extensions: 9557 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -